DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9541 and AT3G60961

DIOPT Version :9

Sequence 1:NP_001260273.1 Gene:CG9541 / 34220 FlyBaseID:FBgn0032083 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_001118870.1 Gene:AT3G60961 / 6241017 AraportID:AT3G60961 Length:136 Species:Arabidopsis thaliana


Alignment Length:124 Identity:34/124 - (27%)
Similarity:61/124 - (49%) Gaps:13/124 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   414 LAAGDMAPE----KSLNQLLETNLRQLRDRTGIIVDGYPRNLQQVKYFENKYKQRPPIIL-LDCS 473
            :|.|.:.|.    |.|.:.:|.:. |:......::||:|||.:....|||..:..|..:| .||.
plant     2 IAEGRIVPSEITVKLLCKAMEESF-QVSGNDKFLIDGFPRNEENRIVFENVARIEPAFVLFFDCP 65

  Fly   474 KLQLGR-------GRIDDTVSSFRRRLELFREQTLPMLKILDTSNRLQIVDGDTDSPSV 525
            :.:|.|       ||.||.:.:.::|.::|.|.|||::....:..:|:.::....|..|
plant    66 EEELERRIMSRNQGREDDNIETIKKRFKVFVESTLPIISYYQSKGKLRKINAAKSSEEV 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9541NP_001260273.1 aden_kin_iso1 67..238 CDD:130427
ADK 70..230 CDD:238713
aden_kin_iso1 358..521 CDD:130427 32/118 (27%)
ADK 359..521 CDD:238713 32/118 (27%)
AT3G60961NP_001118870.1 ADK <1..124 CDD:238713 33/122 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1378291at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.