DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9541 and ak5l

DIOPT Version :9

Sequence 1:NP_001260273.1 Gene:CG9541 / 34220 FlyBaseID:FBgn0032083 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_001017540.1 Gene:ak5l / 548336 ZFINID:ZDB-GENE-050410-2 Length:335 Species:Danio rerio


Alignment Length:246 Identity:66/246 - (26%)
Similarity:113/246 - (45%) Gaps:22/246 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   310 RMDGGPNGAVTALK--------TGTTSADDDSGVVVTQQPKLRQAAGPDESGSDLPPIIWVIGGP 366
            ::||||.......:        ....|.:.||.  :|:...|.|.....:.....|.||::||||
Zfish    81 KLDGGPGPGPGPYRRYDRLPPIQAQFSIESDSD--MTESSGLIQEYDVFDPSKPRPHIIFIIGGP 143

  Fly   367 GSNKATLCLKAVGLNPGWAHISVGRLLRN-ITDSAPRANTESFAVKEALAAGDMAPEKSLNQLLE 430
            ||.|.|...| :.|...:.|:|||.:||| :...|| ::.:...:.:.:|.|::||:::..:.|:
Zfish   144 GSGKGTQTAK-IALRYDFEHVSVGEILRNQLLHHAP-SDRKWELIAQIIANGELAPQETTIEELK 206

  Fly   431 TNLRQLRDRTGIIVDGYPRNLQQVKYFENKYKQRPPIILLDCSKLQL---------GRGRIDDTV 486
            ....:.:|..|.||||:||.:.|...||.:......:|||.||..||         .:||.||..
Zfish   207 QQFIKKQDAKGFIVDGFPREISQAFTFEEQIGSPDLVILLACSNQQLRQRLEKRASQQGRPDDNS 271

  Fly   487 SSFRRRLELFREQTLPMLKILDTSNRLQIVDGDTDSPSVQREFERLIRNHI 537
            .:..:||:.|:.....:.|.......:..||.|.:...:..:...:::..:
Zfish   272 HAIEKRLDTFKHNINLIAKYYQERGLIVRVDADREEDDIFTDISAIVKERL 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9541NP_001260273.1 aden_kin_iso1 67..238 CDD:130427
ADK 70..230 CDD:238713
aden_kin_iso1 358..521 CDD:130427 55/172 (32%)
ADK 359..521 CDD:238713 55/171 (32%)
ak5lNP_001017540.1 aden_kin_iso1 136..314 CDD:130427 55/179 (31%)
ADK 136..310 CDD:238713 55/175 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582285
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1378291at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23359
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3899
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.