Sequence 1: | NP_001260273.1 | Gene: | CG9541 / 34220 | FlyBaseID: | FBgn0032083 | Length: | 646 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_057366.2 | Gene: | AK3 / 50808 | HGNCID: | 17376 | Length: | 227 | Species: | Homo sapiens |
Alignment Length: | 197 | Identity: | 43/197 - (21%) |
---|---|---|---|
Similarity: | 73/197 - (37%) | Gaps: | 50/197 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 362 VIGGPGSNKATLCLKAVGLNPGWAHISVGRLLRNITDSAPRANTESFAVKEALAAGDMAPEKSLN 426
Fly 427 QLLETNLRQLRDRTGIIVDGYPRNLQQVKYFENKY---------------KQRPPIILLDCSKLQ 476
Fly 477 LGRGRI-------------------------DDTVSSFRRRLELFREQTLPMLKILDTSNRLQIV 516
Fly 517 DG 518 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG9541 | NP_001260273.1 | aden_kin_iso1 | 67..238 | CDD:130427 | |
ADK | 70..230 | CDD:238713 | |||
aden_kin_iso1 | 358..521 | CDD:130427 | 43/197 (22%) | ||
ADK | 359..521 | CDD:238713 | 43/197 (22%) | ||
AK3 | NP_057366.2 | ADK | 12..190 | CDD:395329 | 41/187 (22%) |
NMP. /evidence=ECO:0000255|HAMAP-Rule:MF_03169, ECO:0000269|Ref.10 | 37..66 | 9/31 (29%) | |||
LID. /evidence=ECO:0000255|HAMAP-Rule:MF_03169, ECO:0000269|Ref.10 | 127..164 | 2/36 (6%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0563 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR23359 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.910 |