DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9541 and AK3

DIOPT Version :9

Sequence 1:NP_001260273.1 Gene:CG9541 / 34220 FlyBaseID:FBgn0032083 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_057366.2 Gene:AK3 / 50808 HGNCID:17376 Length:227 Species:Homo sapiens


Alignment Length:197 Identity:43/197 - (21%)
Similarity:73/197 - (37%) Gaps:50/197 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   362 VIGGPGSNKATLCLKAVGLNPGWAHISVGRLLRNITDSAPRANTESFAVKEALAAGDMAPEKSLN 426
            ::|.|||.|.|:..: :..:....|:|.|.|||   |:..|........|..:..|.:.|:..:.
Human    12 IMGAPGSGKGTVSSR-ITTHFELKHLSSGDLLR---DNMLRGTEIGVLAKAFIDQGKLIPDDVMT 72

  Fly   427 QLLETNLRQLRDRTGIIVDGYPRNLQQVKYFENKY---------------KQRPPIILLDCSKLQ 476
            :|....|:.|...:.:: ||:||.|.|.:..:..|               |||     |....:.
Human    73 RLALHELKNLTQYSWLL-DGFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQR-----LTARWIH 131

  Fly   477 LGRGRI-------------------------DDTVSSFRRRLELFREQTLPMLKILDTSNRLQIV 516
            ...||:                         ||...:..:||:.:.:||.|:|:.......|:..
Human   132 PASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEDQTKPVLEYYQKKGVLETF 196

  Fly   517 DG 518
            .|
Human   197 SG 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9541NP_001260273.1 aden_kin_iso1 67..238 CDD:130427
ADK 70..230 CDD:238713
aden_kin_iso1 358..521 CDD:130427 43/197 (22%)
ADK 359..521 CDD:238713 43/197 (22%)
AK3NP_057366.2 ADK 12..190 CDD:395329 41/187 (22%)
NMP. /evidence=ECO:0000255|HAMAP-Rule:MF_03169, ECO:0000269|Ref.10 37..66 9/31 (29%)
LID. /evidence=ECO:0000255|HAMAP-Rule:MF_03169, ECO:0000269|Ref.10 127..164 2/36 (6%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23359
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.