DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9541 and ak1

DIOPT Version :9

Sequence 1:NP_001260273.1 Gene:CG9541 / 34220 FlyBaseID:FBgn0032083 Length:646 Species:Drosophila melanogaster
Sequence 2:XP_005168739.1 Gene:ak1 / 445486 ZFINID:ZDB-GENE-040822-37 Length:209 Species:Danio rerio


Alignment Length:226 Identity:56/226 - (24%)
Similarity:98/226 - (43%) Gaps:39/226 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   325 GTTSADDDSGVVVTQQPKLRQAAGPDESGSDLPPIIWVIGGPGSNKATLCLKAVGLNPGWAHISV 389
            |...:...:..|:....|::.|           .|::|:|||||.|.|.|.|.|. ..|:.|:|.
Zfish     2 GLGCSSKSAAAVMKPDDKIKNA-----------KIVFVVGGPGSGKGTQCEKIVA-KYGYTHLSS 54

  Fly   390 GRLLRNITDSAPRANTESFAVKEALAAGDMAPEKSLNQLLETNLRQLRD--------RTGIIVDG 446
            |.|||....|......:..|:   :..|::.|       |:|.|..::|        ..|.::||
Zfish    55 GDLLRAEVASGSERGKQLQAI---MQKGELVP-------LDTVLDMIKDAMIAKADVSKGYLIDG 109

  Fly   447 YPRNLQQVKYFENKYKQRPPIILLDCS-----KLQLGR----GRIDDTVSSFRRRLELFREQTLP 502
            |||.::|.:.||.|......::.:|..     |..:.|    ||.||...:.::||:|:.:.|.|
Zfish   110 YPREVKQGEEFEKKIGAPALLLYIDAKGETMVKRLMKRGETSGRADDNEETIKKRLDLYYKATEP 174

  Fly   503 MLKILDTSNRLQIVDGDTDSPSVQREFERLI 533
            ::...:....::.::.:.....|....|:.|
Zfish   175 VIAFYEQRGIVRKINSELPVDEVFAIVEKAI 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9541NP_001260273.1 aden_kin_iso1 67..238 CDD:130427
ADK 70..230 CDD:238713
aden_kin_iso1 358..521 CDD:130427 49/179 (27%)
ADK 359..521 CDD:238713 49/178 (28%)
ak1XP_005168739.1 aden_kin_iso1 21..208 CDD:130427 53/207 (26%)
ADK 25..197 CDD:238713 49/182 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1378291at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.