DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9541 and ak4

DIOPT Version :9

Sequence 1:NP_001260273.1 Gene:CG9541 / 34220 FlyBaseID:FBgn0032083 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_998464.1 Gene:ak4 / 406590 ZFINID:ZDB-GENE-040426-2505 Length:226 Species:Danio rerio


Alignment Length:238 Identity:51/238 - (21%)
Similarity:94/238 - (39%) Gaps:48/238 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   362 VIGGPGSNKATLCLKAVGLNPGWAHISVGRLLR-NI---TDSAPRANTESFAVKEALAAGDMAPE 422
            ::|.|||.|.|:. :.:..|.|..|:|.|..:| ||   ||:...|.|       .:..|.:.|:
Zfish     9 IMGPPGSGKGTIS-ERIAHNFGLKHLSSGDFVRENISSKTDAGVLAKT-------YINKGLLVPD 65

  Fly   423 KSLNQLLETNLRQLRDRTGIIVDGYPRNLQQVKYFENKYKQRPPIILLDCSKLQLGRGRIDDTVS 487
            ..:.:||...|.:: .:...::||:||.|.|.:...:           .|..         |...
Zfish    66 HVMTRLLLPRLEEM-TKYSWLLDGFPRTLAQAEALNS-----------SCDL---------DVAI 109

  Fly   488 SFRRRLELFREQTL------PMLKILD---TSNRLQIVDGDTDSPSVQREFER---LIR--NHIQ 538
            :....||..:|:..      |..::.:   ...|:|.:|..|....:|:|.:|   |:.  .|.:
Zfish   110 NLNIPLETLKERLRHRWIHPPSGRVYNMCFNPPRIQGLDDITGEALIQQEDDRPEALVARLRHYK 174

  Fly   539 RLLNKTDDIDDSANLGNQMMRNEQTDAILHDLETNVPGAVPTI 581
            .:.....|...:..: .....:.:||.|..::.|.:...:|.|
Zfish   175 DVAKPVIDFYKAKGI-LYTFSDTETDRIWPNINTLLSTKIPAI 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9541NP_001260273.1 aden_kin_iso1 67..238 CDD:130427
ADK 70..230 CDD:238713
aden_kin_iso1 358..521 CDD:130427 38/171 (22%)
ADK 359..521 CDD:238713 38/171 (22%)
ak4NP_998464.1 adk 6..210 CDD:273569 49/230 (21%)
ADK 6..192 CDD:238713 45/212 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582283
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23359
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.