DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9541 and ak3

DIOPT Version :9

Sequence 1:NP_001260273.1 Gene:CG9541 / 34220 FlyBaseID:FBgn0032083 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_998295.2 Gene:ak3 / 406404 ZFINID:ZDB-GENE-040426-2142 Length:225 Species:Danio rerio


Alignment Length:222 Identity:53/222 - (23%)
Similarity:93/222 - (41%) Gaps:53/222 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   362 VIGGPGSNKATLCLKAVGLNPGWAHISVGRLLRNITDSAPRANTES-----FAVKEALAAGDMAP 421
            ::|.|||.|.|:..: :..:.|..|:|.|.:|        |||.|:     ..:|..:..|.:.|
Zfish    11 IMGAPGSGKGTVSSR-IAQSFGLKHLSSGDML--------RANIEAKTDLGLLMKSCIDQGQLVP 66

  Fly   422 EKSLNQLLETNLRQLRDRTGIIVDGYPRNLQQVKYFENKYKQRPPIIL----------LDCSKLQ 476
            :..:::|:.::||.| ::|..::||:||.:.|.:..:..|.....|.|          |....:.
Zfish    67 DDVISRLILSSLRGL-EKTSWLLDGFPRTVAQAEALDCVYDVDSVINLDVPFQTIRERLTSRWVH 130

  Fly   477 LGRGRI-------------------------DDTVSSFRRRLELFREQTLPMLKILDTSNRLQIV 516
            |..||:                         ||:..:..|||:.:..||.|:|:...:...|:..
Zfish   131 LPSGRVYNIDFNPPKKPGLDDVTGEPLVQRDDDSPETVSRRLKDYERQTQPVLEYYRSKGVLETF 195

  Fly   517 DG-DTDS--PSVQREFERLIRNHIQRL 540
            .| :|:.  |.|.....|.|..|.|.:
Zfish   196 SGTETNKIWPHVHTFLSRKIPGHKQAM 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9541NP_001260273.1 aden_kin_iso1 67..238 CDD:130427
ADK 70..230 CDD:238713
aden_kin_iso1 358..521 CDD:130427 46/199 (23%)
ADK 359..521 CDD:238713 46/199 (23%)
ak3NP_998295.2 ADK 8..200 CDD:238713 46/198 (23%)
adk 8..198 CDD:234711 45/196 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23359
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.