Sequence 1: | NP_001260273.1 | Gene: | CG9541 / 34220 | FlyBaseID: | FBgn0032083 | Length: | 646 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_017452195.2 | Gene: | LOC301115 / 301115 | RGDID: | 1588584 | Length: | 212 | Species: | Rattus norvegicus |
Alignment Length: | 204 | Identity: | 62/204 - (30%) |
---|---|---|---|
Similarity: | 102/204 - (50%) | Gaps: | 21/204 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 334 GVVVTQQPKLRQAAGPDESGSDL---PPIIWVIGGPGSNKATLCLKAVGLNPGWAHISVGRLLRN 395
Fly 396 ITDSAPRANTESFAVKEALAAGDMAPEKSLNQLLETNLRQLRDRTGIIVDGYPRNLQQVKYFENK 460
Fly 461 YKQRPPIILL-DCS-----KLQLGRG----RIDDTVSSFRRRLELFREQTLPMLKILDTSNRLQ- 514
Fly 515 -IVDGDTDS 522 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG9541 | NP_001260273.1 | aden_kin_iso1 | 67..238 | CDD:130427 | |
ADK | 70..230 | CDD:238713 | |||
aden_kin_iso1 | 358..521 | CDD:130427 | 53/174 (30%) | ||
ADK | 359..521 | CDD:238713 | 53/173 (31%) | ||
LOC301115 | XP_017452195.2 | aden_kin_iso1 | 28..211 | CDD:130427 | 54/176 (31%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D570177at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |