DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9541 and LOC301115

DIOPT Version :9

Sequence 1:NP_001260273.1 Gene:CG9541 / 34220 FlyBaseID:FBgn0032083 Length:646 Species:Drosophila melanogaster
Sequence 2:XP_017452195.2 Gene:LOC301115 / 301115 RGDID:1588584 Length:212 Species:Rattus norvegicus


Alignment Length:204 Identity:62/204 - (30%)
Similarity:102/204 - (50%) Gaps:21/204 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   334 GVVVTQQPKLRQAAGPDESGSDL---PPIIWVIGGPGSNKATLCLKAVGLNPGWAHISVGRLLRN 395
            |:..:..|:|.:|..|.|  .|:   |.||:|:||||..|.|.| :.:.:..|:.|:.:|:||| 
  Rat     2 GLCESTLPQLGRALRPQE--KDILRYPLIIFVVGGPGCGKGTQC-RNMAMKYGFYHVELGQLLR- 62

  Fly   396 ITDSAPRANTESFAVKEALAAGDMAPEKSLNQLLETNLRQLRDRTGIIVDGYPRNLQQVKYFENK 460
              :.|.|:......:::.:..|.:.|...:..::..||.......|.:|||:||.|:|.|.||..
  Rat    63 --EEAQRSTQRGRQIRDIMQQGLLVPTGLILDMVSDNLLSYPKSRGFLVDGFPRELEQAKEFERI 125

  Fly   461 YKQRPPIILL-DCS-----KLQLGRG----RIDDTVSSFRRRLELFREQTLPMLKILDTSNRLQ- 514
            ..:.|.|::: |||     :..|.||    |.||:..:.|:|||.......|:|......|.|: 
  Rat   126 VGRAPNIVIVFDCSMETMVRRVLRRGQVEHRADDSELAIRKRLETHYTLCEPVLTFYQQKNLLRN 190

  Fly   515 -IVDGDTDS 522
             :.:|..:|
  Rat   191 ILAEGAPES 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9541NP_001260273.1 aden_kin_iso1 67..238 CDD:130427
ADK 70..230 CDD:238713
aden_kin_iso1 358..521 CDD:130427 53/174 (30%)
ADK 359..521 CDD:238713 53/173 (31%)
LOC301115XP_017452195.2 aden_kin_iso1 28..211 CDD:130427 54/176 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D570177at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.