DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9541 and C29F7.3

DIOPT Version :9

Sequence 1:NP_001260273.1 Gene:CG9541 / 34220 FlyBaseID:FBgn0032083 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_510236.1 Gene:C29F7.3 / 181464 WormBaseID:WBGene00007812 Length:191 Species:Caenorhabditis elegans


Alignment Length:173 Identity:50/173 - (28%)
Similarity:87/173 - (50%) Gaps:17/173 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   359 IIWVIGGPGSNKATLCLKAVGLNPGWAHISVGRLLRNITDSAPRANTESFAVKEA-LAAGDMAPE 422
            :::|:|.|||.|.|:|.: :..|.|:.|:|.|.|||   ....||.:|..|:.|. :..|.:.|.
 Worm     4 VVFVLGPPGSGKGTICTQ-IHENLGYVHLSAGDLLR---AERERAGSEYGALIEGHIKNGSIVPV 64

  Fly   423 KSLNQLLETNLRQLRDRTGIIVDGYPRNLQQ----VKYFENKYKQRPPIILLDCSK-------LQ 476
            :....|||..:...:|..|.::||:|||...    .|....|..:: .::.|.|..       |.
 Worm    65 EITCALLENAMIASKDANGFLIDGFPRNEDNWSGWNKQMGGKVNEQ-FVLFLSCPVDVCIDRCLH 128

  Fly   477 LGRGRIDDTVSSFRRRLELFREQTLPMLKILDTSNRLQIVDGD 519
            .|:||.||.|.|.::|:|.:.:.|.|:::..:....::.|:.:
 Worm   129 RGQGRTDDNVESLKKRVETYNQSTFPIIEHFEKVGMVREVNSE 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9541NP_001260273.1 aden_kin_iso1 67..238 CDD:130427
ADK 70..230 CDD:238713
aden_kin_iso1 358..521 CDD:130427 50/173 (29%)
ADK 359..521 CDD:238713 50/173 (29%)
C29F7.3NP_510236.1 UMP_CMP_kin_fam 4..186 CDD:273576 50/173 (29%)
ADK 4..177 CDD:238713 50/173 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1378291at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.