DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9541 and Ak4

DIOPT Version :9

Sequence 1:NP_001260273.1 Gene:CG9541 / 34220 FlyBaseID:FBgn0032083 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_001171073.1 Gene:Ak4 / 11639 MGIID:87979 Length:223 Species:Mus musculus


Alignment Length:183 Identity:48/183 - (26%)
Similarity:78/183 - (42%) Gaps:42/183 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   362 VIGGPGSNKATLCLKAVGLNPGWAHISVGRLLR-NITDSAPRANTE-SFAVKEALAAGDMAPEKS 424
            ::|.|||.|.|:| :.:..|.|..|:|.|.||| |:     :..|| ....|:.|..|.:.|:..
Mouse    10 ILGPPGSGKGTVC-ERIAQNFGLQHLSSGHLLRENL-----KTGTEVGDVAKQYLEKGLLVPDHV 68

  Fly   425 LNQLLETNLRQLRDRTGIIVDGYPRNLQQVKYFENKYKQRPPIILLDCSKLQLGRGRID-DTVSS 488
            :.:|:.:.| :.|.....::||:||.|.|.:..:                     |..| |.|.|
Mouse    69 ITRLMMSEL-ETRSAQHWLLDGFPRTLVQAEALD---------------------GICDVDLVIS 111

  Fly   489 FRRRLELFREQTLPMLKILDTSNR----------LQIVDGDTDSPSVQREFER 531
            .....|..::: |....|..:|.|          :|.:|..|..|.||:|.::
Mouse   112 LNIPFETLKDR-LSRRWIHPSSGRVYNLDFNPPQVQGIDDITGEPLVQQEDDK 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9541NP_001260273.1 aden_kin_iso1 67..238 CDD:130427
ADK 70..230 CDD:238713
aden_kin_iso1 358..521 CDD:130427 43/171 (25%)
ADK 359..521 CDD:238713 43/171 (25%)
Ak4NP_001171073.1 adk 7..211 CDD:273569 48/183 (26%)
NMP. /evidence=ECO:0000255|HAMAP-Rule:MF_03170 35..64 11/33 (33%)
LID. /evidence=ECO:0000255|HAMAP-Rule:MF_03170 125..162 10/36 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838520
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23359
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.