DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9541 and Ak2

DIOPT Version :9

Sequence 1:NP_001260273.1 Gene:CG9541 / 34220 FlyBaseID:FBgn0032083 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_001029138.1 Gene:Ak2 / 11637 MGIID:87978 Length:239 Species:Mus musculus


Alignment Length:204 Identity:41/204 - (20%)
Similarity:81/204 - (39%) Gaps:53/204 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   362 VIGGPGSNKATLCLKAVGLNPGWAHISVGRLLRNITDSAPRANTESFAVKEALAAGDMAPEKSLN 426
            ::|.||:.|.|...| :..|....|::.|.:||.:..|......:   :|..:.||.:..::.:.
Mouse    20 LLGPPGAGKGTQAPK-LAENFCVCHLATGDMLRAMVASGSELGKK---LKATMDAGKLVSDEMVV 80

  Fly   427 QLLETNLRQLRDRTGIIVDGYPRNLQQVKYFENKYKQRPPII-------LLDCSKLQLGRGRI-- 482
            :|:|.||.....:.|.::||:||.::|.:..::..::|...:       :.|...::...||:  
Mouse    81 ELIEKNLETPSCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIQDSLLIRRITGRLIH 145

  Fly   483 -------------------------------DDTVSSFRRRLELFREQTLPMLK---------IL 507
                                           ||...:.:.|||.:..||.|:::         .:
Mouse   146 PKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKTRLEAYHTQTTPLVEYYRKRGIHCAI 210

  Fly   508 DTSNRLQIV 516
            |.|....||
Mouse   211 DASQTPDIV 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9541NP_001260273.1 aden_kin_iso1 67..238 CDD:130427
ADK 70..230 CDD:238713
aden_kin_iso1 358..521 CDD:130427 41/204 (20%)
ADK 359..521 CDD:238713 41/204 (20%)
Ak2NP_001029138.1 ADK 17..219 CDD:238713 39/202 (19%)
ADK 20..204 CDD:278818 37/187 (20%)
NMP. /evidence=ECO:0000255|HAMAP-Rule:MF_03168 45..74 7/31 (23%)
LID. /evidence=ECO:0000255|HAMAP-Rule:MF_03168 141..178 2/36 (6%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.