Sequence 1: | NP_001260273.1 | Gene: | CG9541 / 34220 | FlyBaseID: | FBgn0032083 | Length: | 646 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001029138.1 | Gene: | Ak2 / 11637 | MGIID: | 87978 | Length: | 239 | Species: | Mus musculus |
Alignment Length: | 204 | Identity: | 41/204 - (20%) |
---|---|---|---|
Similarity: | 81/204 - (39%) | Gaps: | 53/204 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 362 VIGGPGSNKATLCLKAVGLNPGWAHISVGRLLRNITDSAPRANTESFAVKEALAAGDMAPEKSLN 426
Fly 427 QLLETNLRQLRDRTGIIVDGYPRNLQQVKYFENKYKQRPPII-------LLDCSKLQLGRGRI-- 482
Fly 483 -------------------------------DDTVSSFRRRLELFREQTLPMLK---------IL 507
Fly 508 DTSNRLQIV 516 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG9541 | NP_001260273.1 | aden_kin_iso1 | 67..238 | CDD:130427 | |
ADK | 70..230 | CDD:238713 | |||
aden_kin_iso1 | 358..521 | CDD:130427 | 41/204 (20%) | ||
ADK | 359..521 | CDD:238713 | 41/204 (20%) | ||
Ak2 | NP_001029138.1 | ADK | 17..219 | CDD:238713 | 39/202 (19%) |
ADK | 20..204 | CDD:278818 | 37/187 (20%) | ||
NMP. /evidence=ECO:0000255|HAMAP-Rule:MF_03168 | 45..74 | 7/31 (23%) | |||
LID. /evidence=ECO:0000255|HAMAP-Rule:MF_03168 | 141..178 | 2/36 (6%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0563 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |