DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C1GalTA and b3glcta

DIOPT Version :9

Sequence 1:NP_609258.1 Gene:C1GalTA / 34215 FlyBaseID:FBgn0032078 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001289180.1 Gene:b3glcta / 799443 ZFINID:ZDB-GENE-110411-147 Length:496 Species:Danio rerio


Alignment Length:159 Identity:48/159 - (30%)
Similarity:75/159 - (47%) Gaps:8/159 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 HQKKARHVKRTWGKRCNKLIFMSSAKDDELDAVALPVGEGRNNLWGKTKEAYKYIYEHHINDADW 176
            |..:...||:||||:.:.|.:.|...|..:..:.|.|........|||....:.....|:...||
Zfish   281 HSDRVPVVKKTWGKQASLLEYYSDYADPSIPTINLGVPNTERGHCGKTFAILRRFLSSHVPRTDW 345

  Fly   177 FLKADDDTYTIVENMRYMLYPYSPETPVYFGCKFKPYVKQG---YMSGGAGYVLSREAVRRFVVE 238
            .|..||||...:..::.:|..|....|:..|.::...:.||   |::||.|.:.||||    ||:
Zfish   346 LLIVDDDTLISLPRLQALLSCYESSEPLCLGERYGYGLGQGGYSYITGGGGMLFSREA----VVQ 406

  Fly   239 ALPNPKLCKSDNSGAEDVEIGKCLQNVNV 267
            .|.:...|.| |...:|:.:|.||.::.|
Zfish   407 LLSSGCNCYS-NDAPDDMVLGMCLNSLRV 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C1GalTANP_609258.1 Galactosyl_T 119..>265 CDD:304462 46/148 (31%)
b3glctaNP_001289180.1 Galactosyl_T 265..468 CDD:304462 48/159 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.