DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C1GalTA and RFNG

DIOPT Version :10

Sequence 1:NP_609258.1 Gene:C1GalTA / 34215 FlyBaseID:FBgn0032078 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_002908.1 Gene:RFNG / 5986 HGNCID:9974 Length:331 Species:Homo sapiens


Alignment Length:198 Identity:50/198 - (25%)
Similarity:74/198 - (37%) Gaps:60/198 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 IMTNPSNHQKKARHVKRTWGKRCNKLIFMSSAKDD-ELDAVALPVGE---GRNNLWGKTKEA--- 162
            :.|...||..:.|.:.|||..|..:..|:.:..|| ||:   |..|:   ..|....:|::|   
Human    64 VKTTRKNHGPRLRLLLRTWISRARQQTFIFTDGDDPELE---LQGGDRVINTNCSAVRTRQALCC 125

  Fly   163 -YKYIYEHHINDA-DWFLKADDDTYTIVENMRYMLYPYSPETPVYFGCKFKP------------- 212
             ....|:..|... .||...|||.|....::.::|..:||...||.|   :|             
Human   126 KMSVEYDKFIESGRKWFCHVDDDNYVNARSLLHLLSSFSPSQDVYLG---RPSLDHPIEATERVQ 187

  Fly   213 ------YVKQGYMSGGAGYVLSR-------------------EAVR-------RFVVEALPNPKL 245
                  .||..:.:||||:.|||                   |.||       .::||.|...:|
Human   188 GGRTVTTVKFWFATGGAGFCLSRGLALKMSPWASLGSFMSTAEQVRLPDDCTVGYIVEGLLGARL 252

  Fly   246 CKS 248
            ..|
Human   253 LHS 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C1GalTANP_609258.1 Galactosyl_T 119..>265 CDD:473923 46/184 (25%)
RFNGNP_002908.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..54
Fringe 55..305 CDD:367085 50/198 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.