DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C1GalTA and CG34452

DIOPT Version :9

Sequence 1:NP_609258.1 Gene:C1GalTA / 34215 FlyBaseID:FBgn0032078 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001097611.2 Gene:CG34452 / 5740876 FlyBaseID:FBgn0085481 Length:318 Species:Drosophila melanogaster


Alignment Length:310 Identity:95/310 - (30%)
Similarity:149/310 - (48%) Gaps:48/310 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 SHDMMEMSGPEQDVGGHEHVHENSTIAERLYSEVRVLCWIMTNPSNHQKKARHVKRTWGKRCNKL 130
            |.:::|..||                     ...|:.|.|.|....|...|.|:.|||.:.|:..
  Fly    40 SREVVESYGP---------------------PPARIFCIISTYAYRHGHAAIHIHRTWVRHCDHY 83

  Fly   131 IFMSSAKDDELDAVA---LPVGEGRNNLWGKTKEAYKYIYEHHINDADWFLKADDDTYTIVENMR 192
            :|:|...|:.|:...   :|      :.|.:.:...:|:|::|.:..||||..:||.:.:|:|:|
  Fly    84 LFVSDDIDNHLEPAVFMNMP------DKWHRMRAYLEYVYKYHFHQGDWFLYCNDDNFVVVDNLR 142

  Fly   193 YMLYPYSPETPVYFGCKFKPYVKQGYMSGGAGYVLSREAVRRFVVEALPNPKLCKSDNSGAE-DV 256
            :||..|||:..:|||||.:......:|..|:|.|.|..|::||.:.||.|..:|.|:..|.: ..
  Fly   143 HMLKTYSPKELIYFGCKLRTTNGLVFMLEGSGIVFSAAALKRFALTALTNESICSSETKGNDFTK 207

  Fly   257 EIGKCLQNVNVLAGDSRDSNGRGRFFPFVPEHHL-------IPSHTDKKFWYWQYIFYKTDEGLD 314
            |:|:||.||||:||||||...|.||.||..:.||       :.:|.    ::..:.:|..::...
  Fly   208 ELGRCLTNVNVIAGDSRDEFQRHRFLPFDADLHLGSSMNESLENHK----YFLDHSYYPVNDMNL 268

  Fly   315 CCSDNAISFHYVSPNQMYVLDYLIYHLRPYGI------INTPDALPNKLA 358
            ..|.::|.||......:|.|.|..|..|.:|:      .|....|.||.|
  Fly   269 PVSLHSICFHVPYTLNIYDLYYFAYKTRIFGVPLNLGFENERMGLENKTA 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C1GalTANP_609258.1 Galactosyl_T 119..>265 CDD:304462 50/149 (34%)
CG34452NP_001097611.2 Galactosyl_T 72..>183 CDD:304462 38/116 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458544
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D103727at6656
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.