DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C1GalTA and CG34451

DIOPT Version :9

Sequence 1:NP_609258.1 Gene:C1GalTA / 34215 FlyBaseID:FBgn0032078 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001369052.1 Gene:CG34451 / 5740612 FlyBaseID:FBgn0085480 Length:307 Species:Drosophila melanogaster


Alignment Length:273 Identity:87/273 - (31%)
Similarity:140/273 - (51%) Gaps:10/273 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 NSTIAERLYSEVRVLCWIMTNPSNHQKKARHVKRTWGKRCNKLIFMSSAKDDELDAVALPVGEGR 152
            |....:.||.|:|:||.|..| .|....|::|||||||.||.|:|:|...|.||:.. :|| ...
  Fly    39 NQHTLDPLYEEIRILCMIPYN-YNSPDTAKYVKRTWGKHCNVLLFVSGDIDGELEPY-VPV-INS 100

  Fly   153 NNLWGKTKEAYKYIYEHHINDADWFLKADDDTYTIVENMRYMLY--PYSPETPVYFGCKFKPYV- 214
            .:.|...::.....|..:.:..||||:.:..::.::||:|||::  .|.|..|:|||.:.:..| 
  Fly   101 TDTWTLVQQGLMQAYLFYADQIDWFLRVEPSSFVVLENLRYMIHKRKYQPSQPIYFGYELENIVT 165

  Fly   215 KQGYMSGGAGYVLSREAVRRFVVEAL-PNPKLCKSDNSGAEDVEIGKCLQNVNVLAGDSRDSNGR 278
            .:.::...:|||:||||:||:.:.:. |..|.|.......|.::|.:||:..||...:|||....
  Fly   166 HESFVHHHSGYVISREALRRYTMASKDPENKECTHWEGYVEGLDIHRCLRFANVTVAESRDEFEH 230

  Fly   279 GRFFPFVPEHHLIPSHTDKKFWYWQYIFYKTDEGLDCCSDNAISFHYVSPNQMYVLDYLIYHLRP 343
            ..|.|...::..:..: |...|..:..::|..|.....|..||.|....|.:||...|.:|.|:.
  Fly   231 ETFLPVTMDYQFLNGY-DTIPWLRKLSYHKRTEKTVPISSRAICFLVEYPPEMYDYYYFVYRLKI 294

  Fly   344 YG--IINTPDALP 354
            :|  :.|:.|..|
  Fly   295 FGTPVRNSIDFRP 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C1GalTANP_609258.1 Galactosyl_T 119..>265 CDD:304462 51/149 (34%)
CG34451NP_001369052.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.