DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C1GalTA and MFNG

DIOPT Version :10

Sequence 1:NP_609258.1 Gene:C1GalTA / 34215 FlyBaseID:FBgn0032078 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_002396.2 Gene:MFNG / 4242 HGNCID:7038 Length:321 Species:Homo sapiens


Alignment Length:70 Identity:17/70 - (24%)
Similarity:30/70 - (42%) Gaps:15/70 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 WFLKADDDTYTIVENMRYMLYPYSPETPVYFG----------CKFKPY-----VKQGYMSGGAGY 225
            ||...|||.|.....:..:|..:.....||.|          .:.:|:     |:..:.:||||:
Human   137 WFCHVDDDNYVNPRALLQLLRAFPLARDVYVGRPSLNRPIHASEPQPHNRTRLVQFWFATGGAGF 201

  Fly   226 VLSRE 230
            .::|:
Human   202 CINRK 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C1GalTANP_609258.1 Galactosyl_T 119..>265 CDD:473923 17/70 (24%)
MFNGNP_002396.2 Fringe 51..300 CDD:367085 17/70 (24%)

Return to query results.
Submit another query.