DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C1GalTA and CG34057

DIOPT Version :9

Sequence 1:NP_609258.1 Gene:C1GalTA / 34215 FlyBaseID:FBgn0032078 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001033980.2 Gene:CG34057 / 3885645 FlyBaseID:FBgn0054057 Length:355 Species:Drosophila melanogaster


Alignment Length:357 Identity:148/357 - (41%)
Similarity:212/357 - (59%) Gaps:29/357 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RSFVSLIVGLIVGFCLAELFVYSTPERSEFMPYDGHRHGDVNDAHHSHDMMEMSGPEQDVGGHEH 84
            |:.:.|::|:::|..|.:...|....|:             ||...|.....:..|   |...||
  Fly    23 RNIIFLVLGIMLGIRLTDFIGYLKLWRN-------------NDLRASEKAALLKYP---VASEEH 71

  Fly    85 VHENSTIAERLYSEVRVLCWIMTNPSNHQKKARHVKRTWGKRCNKLIFMSSAKDDELDAVALPVG 149
                  :|..|..|||:||.::|.||:|..||..|.||||.||||||||||..|..|:.:.:...
  Fly    72 ------LATWLRREVRILCLVLTMPSSHATKAALVNRTWGARCNKLIFMSSQTDSNLNILQINKS 130

  Fly   150 EGRNNLWGKTKEAYKYIYEHHINDADWFLKADDDTYTIVENMRYMLYPYSPETPVYFGCKFKPYV 214
            |.|.||:.|.:....|:::|::|:.|||||||||||.::||:|..||||.||:.|||||:||.|.
  Fly   131 ESRKNLYAKVRTGMAYVHKHYLNEYDWFLKADDDTYIVMENLRLFLYPYDPESSVYFGCRFKAYF 195

  Fly   215 KQGYMSGGAGYVLSREAVRRFVVEALPNPKLCKSDNSGAEDVEIGKCLQNVNVLAGDSRDSNGRG 279
            .|||||||.||||||:|:||..:.||.:..:||. |..:|||:||.|||:|.|:|||:||..|..
  Fly   196 SQGYMSGGGGYVLSRDALRRLNLFALNSTTICKL-NGESEDVQIGHCLQDVGVIAGDTRDFQGHH 259

  Fly   280 RFFPFVPEHHLIPSHTDKKFWYWQYIFYKTDEGLDCCSDNAISFHYVSPNQMYVLDYLIYHLRPY 344
            ||.|..| ..:.|:..... |...|.|:|.::. |||:.:|||||||...:..:.::.:|::|.:
  Fly   260 RFLPVNP-FTVFPTILSNS-WLEGYFFHKPNKS-DCCAASAISFHYVKDFEFELFEFFLYYMRVF 321

  Fly   345 GIINTPDALPNKLA---VGELMPEIKEQATES 373
            |:..||.|||::|.   :.|.:....:|.|::
  Fly   322 GLHRTPRALPSRLGFRQMNERLQHWSQQVTDN 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C1GalTANP_609258.1 Galactosyl_T 119..>265 CDD:304462 82/145 (57%)
CG34057NP_001033980.2 Galactosyl_T 93..>243 CDD:304462 83/150 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458867
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D103727at6656
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.