DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C1GalTA and tgy

DIOPT Version :9

Sequence 1:NP_609258.1 Gene:C1GalTA / 34215 FlyBaseID:FBgn0032078 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001285425.1 Gene:tgy / 32896 FlyBaseID:FBgn0030984 Length:373 Species:Drosophila melanogaster


Alignment Length:283 Identity:139/283 - (49%)
Similarity:185/283 - (65%) Gaps:6/283 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 NSTIAERLYSEVRVLCWIMTNPSNHQKKARHVKRTWGKRCNKLIFMSSAKDDELDAVALPVGEGR 152
            |.|:||:::.|||||||::|.|..|:.:|.||.|||||||||:.||:|..||||..|.|...:..
  Fly    86 NETLAEKMHREVRVLCWVLTTPKYHKTRAIHVLRTWGKRCNKIYFMTSEPDDELPTVVLTKPDRY 150

  Fly   153 NNLWGKTKEAYKYIYEHHINDADWFLKADDDTYTIVENMRYMLYPYSPETPVYFGCKFK----PY 213
            ..||||||||:.:|:|...::||||:|||||||..:||:||||||||||||:|||..:|    ..
  Fly   151 EMLWGKTKEAFVHIHEQMRHEADWFIKADDDTYLFLENLRYMLYPYSPETPIYFGFNYKMVGTHQ 215

  Fly   214 VKQGYMSGGAGYVLSREAVRRFVVEALPNPKLCKSDNSGAEDVEIGKCLQNVNVLAGDSRDSNGR 278
            ..:.|||||:||||||||:|.| .|.:.:...|:.::..|||||:||||.|:.|.||||||...|
  Fly   216 KNESYMSGGSGYVLSREALRIF-AEGVNDTTKCRQEDDHAEDVEMGKCLFNLGVKAGDSRDEQLR 279

  Fly   279 GRFFPFVPEHHLIPSHTDKKFWYWQYIFYKTDEGLDCCSDNAISFHYVSPNQMYVLDYLIYHLRP 343
            .||:|..|...|:..:....||.::|.:|.....:||.|:..::||||...|:||.||..|..:.
  Fly   280 NRFYPIAPYGALLSGNVGMDFWLYKYAYYNPRSCMDCLSEYPVAFHYVHSKQLYVYDYFNYQFQL 344

  Fly   344 YGIINTPDALPNKLAVGEL-MPE 365
            .|.....:.||.|:...|| :||
  Fly   345 SGRAQVAERLPKKIREEELVIPE 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C1GalTANP_609258.1 Galactosyl_T 119..>265 CDD:304462 84/149 (56%)
tgyNP_001285425.1 Galactosyl_T 103..>270 CDD:304462 91/167 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458869
Domainoid 1 1.000 173 1.000 Domainoid score I3636
eggNOG 1 0.900 - - E1_KOG2246
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D103727at6656
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.