DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C1GalTA and lfng

DIOPT Version :10

Sequence 1:NP_609258.1 Gene:C1GalTA / 34215 FlyBaseID:FBgn0032078 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_571046.2 Gene:lfng / 30158 ZFINID:ZDB-GENE-980605-16 Length:374 Species:Danio rerio


Alignment Length:150 Identity:31/150 - (20%)
Similarity:50/150 - (33%) Gaps:29/150 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 IMTNPSNHQKKARHVKRTW-GKRCNKLIFMSSAKDDELDA--------VALPVGEGRNNLWGKTK 160
            :.|....|:.:...:..|| .:...:....:..:|:||..        ........|..|..|..
Zfish   113 VKTTKKFHRSRLDLLLDTWISRNMQQTYIFTDGEDEELKKKIGSHAINTNCSAAHSRQALSCKMA 177

  Fly   161 EAYKYIYEHHINDADWFLKADDDTYTIVENMRYMLYPYSPETPVYFG----------------CK 209
            ..|....|   :...||...|||.|...:.:..:|..|.....:|.|                .|
Zfish   178 VEYDKFIE---SGKKWFCHVDDDNYVNTKTLVKLLSNYPHTQDMYIGKPSLDRPIEATERLGDNK 239

  Fly   210 FKPYVKQGYMSGGAGYVLSR 229
            .:| |...:.:||||:.:||
Zfish   240 MRP-VNFWFATGGAGFCISR 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C1GalTANP_609258.1 Galactosyl_T 119..>265 CDD:473923 28/135 (21%)
lfngNP_571046.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 80..100
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.