DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C1GalTA and F37A4.3

DIOPT Version :9

Sequence 1:NP_609258.1 Gene:C1GalTA / 34215 FlyBaseID:FBgn0032078 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_498472.2 Gene:F37A4.3 / 185403 WormBaseID:WBGene00018133 Length:272 Species:Caenorhabditis elegans


Alignment Length:171 Identity:40/171 - (23%)
Similarity:62/171 - (36%) Gaps:49/171 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 WGKTKEAYKYIYEHHIN-----------DADWFLKADDDTYTIVENMRYMLYPYSPETPVY---- 205
            |.|..|.:..   ||.:           .|.|::.|.|:.|..||.:...|..:....|:|    
 Worm    81 WQKPTEQWLI---HHFSKMILHTRRLPQQAQWYMFAFDNNYFFVERLIKELSKFDSHLPIYTILR 142

  Fly   206 ---FGCKFKPYVKQGYMSGGAGYVLSREAVRRFVVEALPNPKLCKSDNSGAEDVE--IGKCLQNV 265
               ...:.||.:           :.||.|:..|......|   | |:|  ||:||  :..|:...
 Worm   143 DFHADIQHKPVL-----------IFSRSALNTFYDLEEEN---C-SEN--AENVEEWLTTCMSIP 190

  Fly   266 NVLAGDSRDSNGRGRFFPF-----VPEHHLIPS--HTDKKF 299
            .:..  |.|.:.:.|.|..     |.|...:|:  |.||.:
 Worm   191 PITI--SVDRSKKSRIFAIKRHFQVDEMKTMPNDYHDDKDY 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C1GalTANP_609258.1 Galactosyl_T 119..>265 CDD:304462 30/128 (23%)
F37A4.3NP_498472.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.