DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C1GalTA and B3GLCT

DIOPT Version :9

Sequence 1:NP_609258.1 Gene:C1GalTA / 34215 FlyBaseID:FBgn0032078 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_919299.3 Gene:B3GLCT / 145173 HGNCID:20207 Length:498 Species:Homo sapiens


Alignment Length:274 Identity:62/274 - (22%)
Similarity:100/274 - (36%) Gaps:68/274 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 HQKKARHVKRTWGKRCNKLIFMSSAKDDELDAVALPVGEGRNNLWGKTKEAYKYIYEHHINDAD- 175
            |..:...||:||..:.:.:.:.|...::.:..|.|.:........|||..    |.|..:|.:. 
Human   280 HGDRIPIVKQTWESQASLIEYYSDYTENSIPTVDLGIPNTDRGHCGKTFA----ILERFLNRSQD 340

  Fly   176 ---WFLKADDDTYTIVENMRYMLYPYSPETPVYFGCKFKPYVKQG---YMSGGAGYVLSREAVRR 234
               |.:..||||...:..::::|..|....||:.|.::...:..|   |::||.|.|.|||||||
Human   341 KTAWLVIVDDDTLISISRLQHLLSCYDSGEPVFLGERYGYGLGTGGYSYITGGGGMVFSREAVRR 405

  Fly   235 FVVEALPNPKLCKS-DNSGAEDVEIGKCLQNVNVLAGDSRDSNGRGRFFPFVPEHHLIPSHTDKK 298
            .:...      |:. .|...:|:.:|.|.             :|.|     :|..|         
Human   406 LLASK------CRCYSNDAPDDMVLGMCF-------------SGLG-----IPVTH--------- 437

  Fly   299 FWYWQYIFYKTDEGLDCCSDNAISFHYVSPNQMYVLDYLIYHLRPYGIINTPDALPNKLAVGELM 363
                                 :..||...|.. |..||| .|..|.......:..|.|:....|.
Human   438 ---------------------SPLFHQARPVD-YPKDYL-SHQVPISFHKHWNIDPVKVYFTWLA 479

  Fly   364 PEIKEQATESTSDG 377
            |..:::|.:.|..|
Human   480 PSDEDKARQETQKG 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C1GalTANP_609258.1 Galactosyl_T 119..>265 CDD:304462 41/153 (27%)
B3GLCTNP_919299.3 Galactosyl_T 264..467 CDD:304462 55/246 (22%)
Prevents secretion from ER 495..498
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.