DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp29Fa and CD63

DIOPT Version :9

Sequence 1:NP_001162915.1 Gene:Tsp29Fa / 34211 FlyBaseID:FBgn0032074 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001244318.1 Gene:CD63 / 967 HGNCID:1692 Length:238 Species:Homo sapiens


Alignment Length:237 Identity:76/237 - (32%)
Similarity:127/237 - (53%) Gaps:12/237 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GSANAVKYTLFGFNLIFLITGIILIAVGAGVGAVYTGYKLFLAGKFFSIPTFLIVIGSFIIIISF 70
            |....||:.|:...|.|....:.|||||.|...|.:...:..|.....:|..:|.:|.|:.:::|
Human     5 GGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAF 69

  Fly    71 FGCWGALKENYCLVLSFSVMLAIIFILELAAGISGYVLRNDASDLIKTSLTYSLNEYNSINPNAT 135
            .||.||.||||||:::|::.|::|.::|:||.|:|||.|:........:....:..|.  ..|.|
Human    70 VGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYP--KNNHT 132

  Fly   136 TKLWDDIQDEFECCGVTSYNDW--ITAFPNGDLPISCC-NVHVGAVGTFTCNNAQSSVADRHKVG 197
            ..:.|.:|.:|:|||..:|.||  |.:.....:|.||| ||.||....|.    :.::   ||.|
Human   133 ASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFN----EKAI---HKEG 190

  Fly   198 CLDGFSGYISAHAVSLGAAGVVIAILQFFGVIFACYIAREIK 239
            |::...|::..:.:.:.||.:.||.::..|::|||.:.:.|:
Human   191 CVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIR 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp29FaNP_001162915.1 Tetraspannin 11..238 CDD:278750 74/229 (32%)
tetraspanin_LEL 106..210 CDD:239401 30/106 (28%)
CD63NP_001244318.1 Tetraspannin 10..227 CDD:395265 74/225 (33%)
CD63_LEL 105..203 CDD:239419 30/106 (28%)
Lysosomal targeting motif. /evidence=ECO:0000250|UniProtKB:P41731 234..238
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 135 1.000 Domainoid score I4978
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37526
Inparanoid 1 1.050 139 1.000 Inparanoid score I4509
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005733
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_106877
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4418
SonicParanoid 1 1.000 - - X3621
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.790

Return to query results.
Submit another query.