| Sequence 1: | NP_523515.1 | Gene: | Tsp29Fa / 34211 | FlyBaseID: | FBgn0032074 | Length: | 248 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_005253274.1 | Gene: | TSPAN18 / 90139 | HGNCID: | 20660 | Length: | 258 | Species: | Homo sapiens |
| Alignment Length: | 43 | Identity: | 10/43 - (23%) |
|---|---|---|---|
| Similarity: | 18/43 - (41%) | Gaps: | 0/43 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 3 GILFVVHIPSARYERELRRKEQELLAKTATVTTEDEKDGERPS 45 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Tsp29Fa | NP_523515.1 | Tetraspanin | 11..236 | CDD:459767 | 9/35 (26%) |
| tetraspanin_LEL | 126..201 | CDD:351888 | |||
| TSPAN18 | XP_005253274.1 | Tetraspanin | 20..255 | CDD:459767 | 10/43 (23%) |
| uroplakin_I_like_LEL | 115..228 | CDD:239409 | 6/21 (29%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||