DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp29Fa and Tspan1

DIOPT Version :9

Sequence 1:NP_001162915.1 Gene:Tsp29Fa / 34211 FlyBaseID:FBgn0032074 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_598442.1 Gene:Tspan1 / 66805 MGIID:1914055 Length:240 Species:Mus musculus


Alignment Length:239 Identity:72/239 - (30%)
Similarity:111/239 - (46%) Gaps:15/239 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VKYTLFGFNLIFLITGIILIAVGAGVGAVYTGY-KLF-----LAGKFFSIPTFLIVIGSFIIIIS 69
            :|..:|.|||:..:.|..|:|||..|....|.: |:|     .|.:|.::..|||..|:.:.|:.
Mouse     7 IKVMMFLFNLLIFLCGAALLAVGIWVSVDGTSFLKVFGSLSSSAMQFVNVGYFLIAAGAVLFILG 71

  Fly    70 FFGCWGALKENYCLVLSFSVMLAIIFILELAAGISGYVLRNDASDLIKTSLTYSLNEYNSINPNA 134
            |.||:||..||.|:::.|..:|.||||.|:|..:...|....|...: |.|.....|.:......
Mouse    72 FLGCYGAHSENKCVLMMFFSILLIIFIAEIAGAVVALVYTTLAEQFL-TLLVVPAIEKDYGYQTD 135

  Fly   135 TTKLWDDIQDEFECCGVTSYNDW-ITAF--PNGDLPISCCNVHVGAVGTFTCNNAQSSVADRHKV 196
            .|::|:...:|..|||..:|.|: .:.|  .|...|..||    ...|..|........|...||
Mouse   136 FTQVWNTTMEELHCCGFNNYTDFNASRFVKENKVFPPPCC----ANPGNHTVEPCTEEKAKSMKV 196

  Fly   197 -GCLDGFSGYISAHAVSLGAAGVVIAILQFFGVIFACYIAREIK 239
             ||.......|.|:||::|...|.:|.|:...::.:.|:...:|
Mouse   197 QGCFKEILHRIRANAVTVGGVAVGVAALELAAMVVSMYLYCNLK 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp29FaNP_001162915.1 Tetraspannin 11..238 CDD:278750 71/236 (30%)
tetraspanin_LEL 106..210 CDD:239401 27/107 (25%)
Tspan1NP_598442.1 Tetraspannin 7..235 CDD:366035 70/232 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.