DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp29Fa and Tspan6

DIOPT Version :9

Sequence 1:NP_001162915.1 Gene:Tsp29Fa / 34211 FlyBaseID:FBgn0032074 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_062630.2 Gene:Tspan6 / 56496 MGIID:1926264 Length:245 Species:Mus musculus


Alignment Length:241 Identity:71/241 - (29%)
Similarity:112/241 - (46%) Gaps:33/241 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VKYTLFGFNLIFLITGIILIAVGAGVGAVYTGYKLFLAGKFFSIPTFLIVIGSFIIIISFFGCWG 75
            :|..|..:..||.|||:||:|||.........|...|..|..::|..||..|:.||::..|||:.
Mouse    17 LKSVLLIYTFIFWITGVILLAVGIWGKVSLENYFSLLNEKATNVPFVLIGTGTVIILLGTFGCFA 81

  Fly    76 ALKENYCLVLSFSVMLAIIFILELAAGISGYVLRNDASDLIKTSLTYSLNEYNSINPNATTKLWD 140
            ..:.:..::..:::.|.:||::||.|.|.|:|.|::..:..|::...:|.||||.. :..::..|
Mouse    82 TCRASAWMLKLYAMFLTLIFLVELVAAIVGFVFRHEIKNSFKSNYENALKEYNSTG-DYRSEAVD 145

  Fly   141 DIQDEFECCGVTSYNDW-------ITAFPNGDLPISCCNVHVGAVGTFTCNNAQSSVADRHKVGC 198
            .||....|||||:|.||       .|.||.     |||.:.    |.:...:|...    ::.||
Mouse   146 KIQSTLHCCGVTNYGDWKGTNYYSETGFPK-----SCCKLE----GCYPQRDADKV----NEEGC 197

  Fly   199 LDGFSGYISAHAVSLGAAGVV------IAILQFFGVIFACYIAREI 238
                  :|..........|||      :|..|..|:..|..::|.|
Mouse   198 ------FIKVMTTIESEMGVVAGISFGVACFQLIGIFLAYCLSRAI 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp29FaNP_001162915.1 Tetraspannin 11..238 CDD:278750 70/239 (29%)
tetraspanin_LEL 106..210 CDD:239401 30/110 (27%)
Tspan6NP_062630.2 Tetraspannin 17..233 CDD:366035 69/235 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1145558at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.