DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp29Fa and cd63

DIOPT Version :9

Sequence 1:NP_001162915.1 Gene:Tsp29Fa / 34211 FlyBaseID:FBgn0032074 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001016413.1 Gene:cd63 / 549167 XenbaseID:XB-GENE-1015227 Length:238 Species:Xenopus tropicalis


Alignment Length:239 Identity:77/239 - (32%)
Similarity:124/239 - (51%) Gaps:16/239 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GSANAVKYTLFGFNLIFLITGIILIAVGAGVGAVYTGYKLFLAGKFFS-IPTFLIVIGSFIIIIS 69
            |....||:.:|.||.:|.:.||.|||:|..| .:...:.|.:.....| .|..:||:|..|.:|:
 Frog     5 GGMKCVKFLMFFFNFVFWVCGIALIAIGIYV-QIQLNHTLIMKNATSSGAPIVIIVVGVVIFLIA 68

  Fly    70 FFGCWGALKENYCLVLSFSVMLAIIFILELAAGISGYVLRNDASDLIKTSLTYSLNEYNSINPNA 134
            ||||.||||||||:|.:|:|:|.:||::|:||.|:.||.::......:.|....:..||.....|
 Frog    69 FFGCCGALKENYCMVTTFAVVLVLIFLVEIAAAIAAYVYKDKLRTAFEDSFKNGMVHYNDTKDIA 133

  Fly   135 TTKLWDDIQDEFECCGVTSYNDWITAFP---NGDLPISCC-NVHVGAVGTFTCNNAQSSVADRHK 195
            .:  .|.:|.||:|||..:..||....|   ...:|.||| |:..|.        .:..:|:.:.
 Frog   134 DS--IDLLQKEFQCCGAINSTDWRQYAPFTGTNTVPDSCCKNITAGC--------GKGPIANINS 188

  Fly   196 VGCLDGFSGYISAHAVSLGAAGVVIAILQFFGVIFACYIAREIK 239
            .||..|...::..:...:....:.||:.:..|::|||.:.:.|:
 Frog   189 EGCATGIDQWVKKNVGIVAGVALGIALFEILGIVFACCLMKGIR 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp29FaNP_001162915.1 Tetraspannin 11..238 CDD:278750 75/231 (32%)
tetraspanin_LEL 106..210 CDD:239401 26/107 (24%)
cd63NP_001016413.1 Tetraspannin 22..227 CDD:366035 69/215 (32%)
tetraspanin_LEL 105..203 CDD:351888 26/107 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H37526
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005733
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3621
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.