DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp29Fa and Tsp97E

DIOPT Version :9

Sequence 1:NP_001162915.1 Gene:Tsp29Fa / 34211 FlyBaseID:FBgn0032074 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001263002.1 Gene:Tsp97E / 43241 FlyBaseID:FBgn0039465 Length:228 Species:Drosophila melanogaster


Alignment Length:258 Identity:52/258 - (20%)
Similarity:94/258 - (36%) Gaps:60/258 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTGSANAVKYTLFGFNLIFLITGIILIAVGAGVGAVYTGYKLFLAGKFFSIPTFLIVIGS----- 63
            :.|.....|..|...|:::::.|.:||.||     ||        .:..||.|.|.::|.     
  Fly     1 MCGGFTCSKNALIALNILYVMIGFLLIGVG-----VY--------ARAASIVTNLPIVGGILACG 52

  Fly    64 -FIIIISFFGCWGALKENYCLVLSFSVMLAIIFILELAAGISGYVLRNDASDLIKTSLTYSLNEY 127
             .:|.||..|..||:|.:..::..:.::|.::|:::.:...|...:.::...      .::...:
  Fly    53 VILICISMLGLAGAVKHHQVMLFFYMIILFMLFLIQFSIASSCLAVNSEQQQ------QFAEQGW 111

  Fly   128 NSINPNATTKLWDDIQDEFECCGVTSYNDWITA-FPNGDLPI------SCCNVHVGAVGTFTCNN 185
            .::    .|.|...:||..:|||..:.....|: .|..:.|.      .||              
  Fly   112 MTV----PTDLRKQVQDSLKCCGFNATAPSTTSVVPPSNEPSCELINQQCC-------------- 158

  Fly   186 AQSSVADRHKVGCLDGFSGYISAHAVSLGAAGVVIAILQFFGVIFA---------CYI-AREI 238
            |.||..|.....|.......|.......|..|:..:..:...|..|         ||: ||.:
  Fly   159 AHSSEPDCRCEPCGPLLEDKIDYAFKLCGGLGIFFSFTEVLAVFLARRYRNQHDPCYLPARAV 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp29FaNP_001162915.1 Tetraspannin 11..238 CDD:278750 51/249 (20%)
tetraspanin_LEL 106..210 CDD:239401 18/110 (16%)
Tsp97ENP_001263002.1 Tetraspannin 7..204 CDD:278750 46/233 (20%)
tetraspanin_LEL <121..177 CDD:243179 15/69 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442887
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.