DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp29Fa and Tsp96F

DIOPT Version :9

Sequence 1:NP_001162915.1 Gene:Tsp29Fa / 34211 FlyBaseID:FBgn0032074 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001262976.1 Gene:Tsp96F / 43127 FlyBaseID:FBgn0027865 Length:284 Species:Drosophila melanogaster


Alignment Length:289 Identity:65/289 - (22%)
Similarity:121/289 - (41%) Gaps:78/289 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTGSANAVKYTLFGFNLIFLITGIILIAVGAGVGAVYTGYKLFLAGKFFSIPTFL---------- 58
            |.|..:.|||.:...|::|.:.|:.::     |.:|:          ..:.|||:          
  Fly     3 LNGCCSCVKYLMVLINILFWLIGLTIV-----VTSVW----------MLTDPTFMLSMTQNYNHY 52

  Fly    59 -------IVIGSFIIIISFFGCWGALKENYCLVLSFSVMLAIIFILELAAGISGYVLRNDASDLI 116
                   :.||..|.:.:||||.|..:|:.||::||..::.|:.:.::|||...:..::...|::
  Fly    53 HIALYVFLAIGILITLGAFFGCCGVCRESQCLLVSFFCVILIVMVAQIAAGAWAFHNKDKLDDIV 117

  Fly   117 KTSLTYSL-NEYNSINPNATTKLWDDIQDEFECCGVTSYNDWITA-FPNGD-------------- 165
            :.::..|: .||.....::.|..:|.:|...:|||.....||.|: |.|.|              
  Fly   118 RAAVKSSVQEEYGQSTMSSRTVTFDTLQKNLKCCGADGPGDWATSRFNNVDRTNIVEIAVSSMNV 182

  Fly   166 ---LPISCCNVHV--------------GAVGTFTCNNAQSSVADRHKVGCLDGFSGYISAHAVSL 213
               :|.|||..::              |.:     |||      .::.||:|.....|..:.|::
  Fly   183 FYNIPESCCKDNLKDNECELSRRLKFGGPL-----NNA------IYQQGCVDKLIEIIYENWVTI 236

  Fly   214 GAAGVVIAILQFFGVIFACYIAREIKIRN 242
            .|....:.:|:...:.||..:.  ..:||
  Fly   237 FAVTAAVILLELLSLTFALSLC--CAVRN 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp29FaNP_001162915.1 Tetraspannin 11..238 CDD:278750 61/276 (22%)
tetraspanin_LEL 106..210 CDD:239401 28/136 (21%)
Tsp96FNP_001262976.1 Tetraspannin 9..261 CDD:278750 61/279 (22%)
CD151_like_LEL 107..233 CDD:239408 28/136 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443056
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.