DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp29Fa and Tsp86D

DIOPT Version :9

Sequence 1:NP_001162915.1 Gene:Tsp29Fa / 34211 FlyBaseID:FBgn0032074 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001262468.1 Gene:Tsp86D / 41310 FlyBaseID:FBgn0037848 Length:316 Species:Drosophila melanogaster


Alignment Length:264 Identity:68/264 - (25%)
Similarity:119/264 - (45%) Gaps:43/264 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ANAVKYTLFGFNLIFLITGIILIAVGAGVGAVYTGYKLFLAGK-----------FFSIPTFLIVI 61
            ::.|||.:|..|.:|.:.|.:|:|:|     ||......:.|.           .|:|...:|:.
  Fly    28 SSCVKYMIFLLNFLFWLFGGLLLAIG-----VYAFMDKLMDGNGWLRLDTIYDVIFNISLVMIIA 87

  Fly    62 GSFIIIISFFGCWGALKENYCLVLSFSVMLAIIFILELAAGISGYVLRNDASDLIKTSLTYS-LN 125
            |..:..:||.||.|||:||..|:..:|:.|.:.||||::..|..:|.....:..::...|.. ::
  Fly    88 GVIVFTVSFAGCLGALRENTWLLKLYSMCLLLFFILEMSLAIICFVFPQYMNSFLEYQFTDKIIH 152

  Fly   126 EYNSINPNATTKLWDDIQDEFECCGVTS--YNDWI------TAFPNGD---LPISCC----NVHV 175
            .|.  :.:......|..|.||.|||:::  |.||.      .:.|:.:   :|.|||    ::..
  Fly   153 SYR--DDSDLQNFIDFAQQEFNCCGLSNAGYQDWSKNEYFNCSSPSVERCGVPYSCCINATDISS 215

  Fly   176 GAVGTFTCNNAQ-SSVADRHK----VGCLDGFSGYISAHAVSLGAAGVVIAILQFFGVIFACYIA 235
            |.|........| .|||...|    .||::....::..:...:....:.||:||    :|..|:|
  Fly   216 GLVNIMCGYGVQVRSVAAASKRIWTSGCIEIVRVWVERNLYVIAGVALGIALLQ----LFVIYLA 276

  Fly   236 REIK 239
            :.::
  Fly   277 KTLE 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp29FaNP_001162915.1 Tetraspannin 11..238 CDD:278750 68/258 (26%)
tetraspanin_LEL 106..210 CDD:239401 27/124 (22%)
Tsp86DNP_001262468.1 Tetraspannin 51..283 CDD:278750 60/241 (25%)
penumbra_like_LEL 132..255 CDD:239411 27/124 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442928
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.