DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp29Fa and Tsp74F

DIOPT Version :9

Sequence 1:NP_001162915.1 Gene:Tsp29Fa / 34211 FlyBaseID:FBgn0032074 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_524132.1 Gene:Tsp74F / 39995 FlyBaseID:FBgn0036769 Length:236 Species:Drosophila melanogaster


Alignment Length:232 Identity:69/232 - (29%)
Similarity:117/232 - (50%) Gaps:12/232 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VKYTLFGFNLIFLITGIILIAVGAGVGAVYTGYKLFLAGKFFSIPTFLIVIGSFII-IISFFGCW 74
            |||:||..|.:..:.|.|:..:........:.....|....||...:::::.|.|| ::||.||.
  Fly    14 VKYSLFIANFVIFVGGAIVFCLTLWTLVDRSFVNELLGTNLFSGAVYVLLVTSIIICLVSFLGCV 78

  Fly    75 GALKENYCLVLSFSVMLAIIFILELAAGISGYVLRNDASDLIKTSLTYSLNEYNSINPNATTKLW 139
            ||.||..||:|::.:::|::|:..|..|:.|||.|......::..:..::..|.|  ....|:.|
  Fly    79 GAGKEVKCLLLTYFIIVALVFVTMLIGGVLGYVFRERVQQTMRQEMRSTMALYGS--RREITQAW 141

  Fly   140 DDIQDEFECCGVTSYNDWITAFPN--GDLPISCCNVHVGAVGTFTCNNAQSSVADRHKVGCLDGF 202
            |..|:..:||||.:::||     |  |.:|.|||....|  |.........::.:.:..|||...
  Fly   142 DLTQERLQCCGVDTWHDW-----NRYGPVPESCCQELFG--GQRKECTIFPTITNLYNQGCLYVT 199

  Fly   203 SGYISAHAVSLGAAGVVIAILQFFGVIFACYIAREIK 239
            :.:|..||..:|...:.:|||..||:||:|.:...|:
  Fly   200 TNFIRDHAAVIGGTSIAVAILMIFGMIFSCLLFNMIE 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp29FaNP_001162915.1 Tetraspannin 11..238 CDD:278750 68/229 (30%)
tetraspanin_LEL 106..210 CDD:239401 27/105 (26%)
Tsp74FNP_524132.1 Tetraspannin 14..231 CDD:395265 68/225 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 140 1.000 Inparanoid score I4480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D130922at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4418
SonicParanoid 00.000 Not matched by this tool.
66.000

Return to query results.
Submit another query.