DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp29Fa and TM4SF

DIOPT Version :9

Sequence 1:NP_001162915.1 Gene:Tsp29Fa / 34211 FlyBaseID:FBgn0032074 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001261159.1 Gene:TM4SF / 37786 FlyBaseID:FBgn0020372 Length:292 Species:Drosophila melanogaster


Alignment Length:233 Identity:57/233 - (24%)
Similarity:100/233 - (42%) Gaps:29/233 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KYTLFGFNLIFLITGIILIAVGAGV---GAVYTGYKLFLAGKFFSIPTFLIVIGSFIIIISFFGC 73
            ||.::.:.::..:||...|.:|..:   .:||.|   .:..|.::....|:.:|....|:.:.||
  Fly    11 KYLVYSYVVLLALTGAAQIFLGTSLLWGHSVYYG---IVQNKLWAPAAILLCLGPVTFILCWMGC 72

  Fly    74 WGALKENYCLVLSFSVML-AIIFILELAAGISGYVLRNDASDLIKTSLTYSLNEYNSINPNATTK 137
            ....:...||:..|:.:| |.|.:..:..|.| ..:|.:....::..:..|..|:  ::..:.||
  Fly    73 QATNQRKRCLLGMFAALLVACICVQFIICGWS-LAMRENLPTSVEIFIDDSFVEF--LDKFSRTK 134

  Fly   138 -----LWDDIQDEFECCGVTSYNDWITAFPNGDLPISCCNVHVGAVGTFTCNNAQSSVADRH-KV 196
                 ||:.:|.:.:||||....|    :....||.|||:         ...:|..|..|.| |.
  Fly   135 VDNLHLWNRMQSQLQCCGVDGPLD----YRRLSLPWSCCS---------RPEHAYESACDTHYKR 186

  Fly   197 GCLDGFSGYISAHAVSLGAAGVVIAILQFFGVIFACYI 234
            |||...|..|....:.......:|||.|..|:..|.::
  Fly   187 GCLAVVSEQIRNRLLITAFGAAIIAIFQSLGIFCAVHL 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp29FaNP_001162915.1 Tetraspannin 11..238 CDD:278750 57/233 (24%)
tetraspanin_LEL 106..210 CDD:239401 28/109 (26%)
TM4SFNP_001261159.1 Tetraspannin 9..224 CDD:278750 57/231 (25%)
uroplakin_I_like_LEL 111..197 CDD:239409 26/100 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.