DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp29Fa and Tsp42Eo

DIOPT Version :9

Sequence 1:NP_001162915.1 Gene:Tsp29Fa / 34211 FlyBaseID:FBgn0032074 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_523641.2 Gene:Tsp42Eo / 35625 FlyBaseID:FBgn0033136 Length:219 Species:Drosophila melanogaster


Alignment Length:254 Identity:52/254 - (20%)
Similarity:98/254 - (38%) Gaps:71/254 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VKYTLFGFNLIFLITGIILIAVGAGVGAVYTGYKL--FLAGKFFSIPTFL-IVIGSFIIIISFFG 72
            :::|...|:.:.||.|:  :|..|||      |:|  |..|.......|: :.:...:|:....|
  Fly     8 LQWTSVVFSTLTLIVGV--LAALAGV------YELDKFNEGSAEHTEKFVQLGMAGALILAGLVG 64

  Fly    73 CWGALKENYCLVLSF-SVMLAIIFILELAAGISGYVLRNDASDLIKTSLTYSLNEYNSINPNATT 136
            |.||:         | |:.:.::.::.|.|.|:.::              :.::.||.......|
  Fly    65 CLGAI---------FGSIKVMVVNLILLLALIASHI--------------WKVSHYNETKQLDAT 106

  Fly   137 K-----LW----------DDIQDEFECCGVTSYNDWITAFPNGDLPISCCNVHVGAVGTFTCNNA 186
            :     ||          .|:|.|:||||...::|:.:.  |..:|.||.:...|....:.    
  Fly   107 EVYVMDLWMKELVHHGAMQDLQQEYECCGDKGFSDYTSL--NMKVPRSCFHTKDGIHALYP---- 165

  Fly   187 QSSVADRHKVGCLDGFS-GYISAHA----VSLGAAGV-VIAILQFFGVIFACYIAREIK 239
                   :..||:.... .|:..:.    |..|..|. |:.|:  .|:...|.:..:.:
  Fly   166 -------YGEGCMAAVKRAYLQIYRYEKWVHCGLIGYEVVGII--LGITLCCQLTNKTR 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp29FaNP_001162915.1 Tetraspannin 11..238 CDD:278750 52/251 (21%)
tetraspanin_LEL 106..210 CDD:239401 21/119 (18%)
Tsp42EoNP_523641.2 Tetraspannin 7..210 CDD:278750 52/247 (21%)
tetraspanin_LEL 110..178 CDD:239401 17/80 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.