DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp29Fa and lbm

DIOPT Version :9

Sequence 1:NP_001162915.1 Gene:Tsp29Fa / 34211 FlyBaseID:FBgn0032074 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001260757.1 Gene:lbm / 35623 FlyBaseID:FBgn0016032 Length:208 Species:Drosophila melanogaster


Alignment Length:226 Identity:44/226 - (19%)
Similarity:88/226 - (38%) Gaps:45/226 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ITGIILIAV--GAGVGAV-YTGYKLFLAGKFFSIPTFLIVIGSFIIIISFFGCWGALKENYCLVL 85
            |..|:|.||  ....||: :..|......:.|.|..::..  |.|::.:..|.:.|::|:..|..
  Fly    10 IASIVLNAVLGFLAAGAIGWIAYNADTETEEFVIAAYIAC--SLILVFALLGIFAAIRESVVLTA 72

  Fly    86 SFSVMLAIIFILELAAGISGYVLRNDASDLIKTSLTYSLNEYNSINPNATTKL-W-----DDIQD 144
            :.:|.|.|:.||:                ::.|.|  .|:|::..:.....:: |     |.:|.
  Fly    73 TSAVFLLILAILQ----------------IVSTCL--FLHEFDVKSGRDMVEVAWQANNMDSLQQ 119

  Fly   145 EFECCGVTSYNDWITAFPNGDLPISCCNVHVGAVGTFTC-NNAQSSVADRHKVGCLDGFSGYISA 208
            :.||||.:|..|:|               |:..:...:| .:.|.:....:..||::....:..:
  Fly   120 KHECCGQSSAQDYI---------------HLSLLIPPSCYADLQQTPDHLYLDGCIEKVQSFYES 169

  Fly   209 HAVSLGAAGVVIAILQFFGVIFACYIAREIK 239
            ..:.......|:...:......|.::|...|
  Fly   170 DKLRFIIVSWVLVAFELICFALAVFLAISFK 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp29FaNP_001162915.1 Tetraspannin 11..238 CDD:278750 43/223 (19%)
tetraspanin_LEL 106..210 CDD:239401 19/110 (17%)
lbmNP_001260757.1 Tetraspannin 8..198 CDD:278750 43/222 (19%)
tetraspanin_LEL <109..169 CDD:239401 15/74 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442986
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.