DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp29Fa and Tsp42El

DIOPT Version :9

Sequence 1:NP_001162915.1 Gene:Tsp29Fa / 34211 FlyBaseID:FBgn0032074 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_523638.1 Gene:Tsp42El / 35622 FlyBaseID:FBgn0033134 Length:217 Species:Drosophila melanogaster


Alignment Length:241 Identity:65/241 - (26%)
Similarity:111/241 - (46%) Gaps:56/241 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLLTGSANAVKYTLFGFNLIFLITGI-ILIAVGAGVGAVYTGYKLFLAGKFFSIPTFLIVIGSF 64
            |...||:   :||:||.||.::.|.|| :||..|.|.||:...|.:           .::::|..
  Fly     1 MGCATGT---IKYSLFLFNALWAILGILVLIFGGLGWGAMPDAYAI-----------GILILGGT 51

  Fly    65 IIIISFFGCWGALKENYCLVLSFSVMLAIIFILELAAGISGYVLRNDASDLIKTSLTYSLN---- 125
            |::||.|||.||::|:..::.:::.:|.|:.:|     |..:::.| ..|:.|   .|:|.    
  Fly    52 ILVISLFGCCGAVRESPRMLWTYASLLLILLLL-----IVAFIILN-PKDVFK---KYALQTVEN 107

  Fly   126 --EYNSINPNATTKLWDDIQDEFECCGVTSYNDWI-TAFPNGDLPISCCNVHVGAVGTFTCNNAQ 187
              |.....|.:    .|.||..:.|||..|..|:: ..|.|..:|.|||.       ..:|.|. 
  Fly   108 QWELEQTKPGS----MDIIQKTYYCCGRDSAQDYLDIKFWNNTVPSSCCK-------DDSCVNP- 160

  Fly   188 SSVADRHKVGCL----DGFS------GYISAHAVSLGAAGVVIAIL 223
               .:.:..|||    :.|:      ||:....:...|..:::||:
  Fly   161 ---LNLYVRGCLIKVEEAFADEATTLGYLEWGLLGFNAVILLLAII 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp29FaNP_001162915.1 Tetraspannin 11..238 CDD:278750 62/231 (27%)
tetraspanin_LEL 106..210 CDD:239401 29/120 (24%)
Tsp42ElNP_523638.1 Tetraspannin 7..196 CDD:278750 59/226 (26%)
tetraspanin_LEL 94..178 CDD:239401 26/101 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443030
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.