DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp29Fa and Tsp42Ei

DIOPT Version :9

Sequence 1:NP_001162915.1 Gene:Tsp29Fa / 34211 FlyBaseID:FBgn0032074 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001260756.1 Gene:Tsp42Ei / 35618 FlyBaseID:FBgn0033130 Length:229 Species:Drosophila melanogaster


Alignment Length:252 Identity:66/252 - (26%)
Similarity:103/252 - (40%) Gaps:58/252 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ANAVKYTLFGFNLIFLITGIILIAVG------AGVGAVYTGYKLFLAGKFFSIPTFLIVIGSFII 66
            |..||:.|...|.:|.:.|:.|||.|      |...||..|..  :||      ..:|.:|..|:
  Fly     5 ATTVKHVLLLLNFVFSVLGLALIAFGIFFLISAAENAVSIGKN--VAG------GLIIALGVVIL 61

  Fly    67 IISFFGCWGALKENYCLVLSF-----SVMLAIIFILELAA-----GISGYVLRNDASDLI---KT 118
            ||:.|||..|:.|....:|.:     .::||.:..|.:::     ||||.:  |:..|.:   :.
  Fly    62 IIAIFGCLAAIHEAPVRLLIYVGAVVLLILAQLIFLGMSSHGTKDGISGSI--NEGFDRLWESER 124

  Fly   119 SLTYSLNEYNSINPNATTKLWDDIQDEFECCGVTSYND-WITAFPNGDLPISCCNVHVGAVGTFT 182
            :.|.:|:.|.|         |      .:||||.|..| ||.   :..:|.|||       ....
  Fly   125 NQTGALSYYES---------W------LQCCGVNSSEDYWII---HHGIPSSCC-------PESK 164

  Fly   183 CNNAQSSVADRHKVGCLDGFSGYISAHAVSLGAAGVVIAILQFFGVIFACYIAREIK 239
            |.:..|.|   .|.||...|..|:....:.......::.|.:..|.:|...:...:|
  Fly   165 CMDTPSRV---FKTGCKAAFVKYLDDKLLVFKIVCWLLVIGEAVGAVFGWLLYSSVK 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp29FaNP_001162915.1 Tetraspannin 11..238 CDD:278750 64/246 (26%)
tetraspanin_LEL 106..210 CDD:239401 27/107 (25%)
Tsp42EiNP_001260756.1 Tetraspannin 7..217 CDD:278750 64/247 (26%)
DUF373 <17..>101 CDD:299895 26/91 (29%)
tetraspanin_LEL 104..189 CDD:239401 31/114 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443026
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.