DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp29Fa and Tsp42Ed

DIOPT Version :9

Sequence 1:NP_001162915.1 Gene:Tsp29Fa / 34211 FlyBaseID:FBgn0032074 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001286152.1 Gene:Tsp42Ed / 35613 FlyBaseID:FBgn0029507 Length:227 Species:Drosophila melanogaster


Alignment Length:243 Identity:63/243 - (25%)
Similarity:117/243 - (48%) Gaps:45/243 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VKYTLFGFNLIFLITGIILIAVG----------AGVGAVYTGYKLFLAGKFFSIPTFLIVIGSFI 65
            |||.||.||::|:|.||:||..|          :|||..:|..         |:...::|:|..:
  Fly     8 VKYVLFIFNILFVICGILLITFGSIMVSTIKDFSGVGETFTAN---------SVAIIILVLGCVV 63

  Fly    66 IIISFFGCWGALKENYCLVLSFSVMLAIIFILELAAGISGYV----LRNDASDLIKTSLTYSLNE 126
            .:::|.||.||::||.|.:.|:||::.::.:.:||..|..:|    ::.....:::|  .:...:
  Fly    64 FLVAFMGCCGAIRENSCALTSYSVVMLVLLVSQLALIIYVWVDHVQIQQSLEKIVQT--IWDQRK 126

  Fly   127 YNSINPNATTKLWDDIQDEFECCGVTSYNDWITAFPNGDLPISCCNVHVGAVGTFTCNNAQSSVA 191
            .:::       |.|.:|..|:|||:..:.|:...:     |.|||:    :....||  |.:.|.
  Fly   127 TDAL-------LMDTLQRSFKCCGLNGFADYGITY-----PASCCD----SPSNGTC--ALTQVM 173

  Fly   192 DRHKVGCLDGFSGYISAHAVSLGAAGVVIAILQFFGVIFACYIAREIK 239
            .|.  .||.....:...:...:..||:.:..::....||||.:|.:.:
  Fly   174 TRS--SCLKAVDSFWDTNVSIIKYAGLGVTAVELVAFIFACCLANQTR 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp29FaNP_001162915.1 Tetraspannin 11..238 CDD:278750 63/240 (26%)
tetraspanin_LEL 106..210 CDD:239401 21/107 (20%)
Tsp42EdNP_001286152.1 Tetraspannin 8..217 CDD:278750 63/239 (26%)
tetraspanin_LEL 104..189 CDD:239401 21/106 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443010
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.