DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp29Fa and Tsp33B

DIOPT Version :9

Sequence 1:NP_001162915.1 Gene:Tsp29Fa / 34211 FlyBaseID:FBgn0032074 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_523552.1 Gene:Tsp33B / 34590 FlyBaseID:FBgn0032376 Length:326 Species:Drosophila melanogaster


Alignment Length:259 Identity:65/259 - (25%)
Similarity:97/259 - (37%) Gaps:72/259 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 IFLIT----GIILIAVGAGVGAVYTGYK-----LFLAGKFFSIPTF-LIVIGSFIIIISFFGCWG 75
            :.|||    |::::.|.|....|.|||.     ..:.|..|.|..| ..|:.:|:..|:.   |.
  Fly    14 LLLITEAVIGLLILVVTAYYHTVLTGYLSDIECRLVYGYLFGIYVFGAQVVVTFLCSIAM---WR 75

  Fly    76 ALKENYC-----LVLSFSVMLAIIFIL-------ELAAGISGYVLRNDASDLIKTSLTYSLNEYN 128
            .:....|     |:||.....:.:.|.       .|..|:.  ||.|.|.    ||||..::.|.
  Fly    76 RIWRRRCTPNIRLLLSVWAFYSCVIIASGFGCVWNLYRGVD--VLENAAD----TSLTRGIDMYY 134

  Fly   129 SINPNATTKLWDDIQDEFECCGVTSYNDWITA--FPNGD--------LPISCC--------NVHV 175
            |. |. ...|||.:|...|||||..|.||:.|  .|..:        .|.:||        |..:
  Fly   135 SC-PE-WKLLWDGLQWHKECCGVHGYKDWMNAEWMPRRENNCTSMVLAPFACCKRSCDSCFNNFL 197

  Fly   176 GAVGTFTCNNAQS-----SVADRHKVGCLDGFSGYISAHAVSLGAAGVVIAILQFFGVIFACYI 234
            .:.|.....|::.     :|...:..|||..|                |.|:...|.::.|.::
  Fly   198 PSEGQSIGGNSRQPFPALTVDSINANGCLPAF----------------VSAVWNCFYILMALWV 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp29FaNP_001162915.1 Tetraspannin 11..238 CDD:278750 65/259 (25%)
tetraspanin_LEL 106..210 CDD:239401 36/126 (29%)
Tsp33BNP_523552.1 Tetraspannin 20..256 CDD:278750 62/253 (25%)
CD151_like_LEL 112..237 CDD:239408 39/148 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449969
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.