DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp29Fa and Tsp2A

DIOPT Version :9

Sequence 1:NP_001162915.1 Gene:Tsp29Fa / 34211 FlyBaseID:FBgn0032074 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001188523.1 Gene:Tsp2A / 31080 FlyBaseID:FBgn0024361 Length:244 Species:Drosophila melanogaster


Alignment Length:231 Identity:61/231 - (26%)
Similarity:98/231 - (42%) Gaps:39/231 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VKYTLFGFNLI--FLITGIILIAVGAGVGAVYTGYKLFLAGKFFSIPTFLIV-IGSFIIIISFFG 72
            ||||||.||::  .:.|.:..:.|.......:..:...|..:.|.|..:::: |...::.:||.|
  Fly    19 VKYTLFCFNIVAWMISTALFALTVWLRAEPGFNDWLRILEAQSFYIGVYVLIGISIVMMAVSFLG 83

  Fly    73 CWGALKENYCLVLSFSVMLAIIFILELAAG----ISGYVLRNDASDLIKTSLT--YSLNEYNSIN 131
            |..||.|| .|.|...|...:...:.:.||    :....:.:....|:..||.  .:.:||...|
  Fly    84 CLSALMEN-TLALFVFVGTQVFGFIAIVAGSAVLLQFSTINSSLQPLLNVSLRGFVATSEYTYSN 147

  Fly   132 PNATTKLWDDIQDEFECCGVTSYNDWITAFPNGDLPISCCNVHVGAVGTFTCNNAQSSVADRHKV 196
            ...|.     ||:...|||.|...|::..  ...||.||.:...|        ||..:       
  Fly   148 YVLTM-----IQENIGCCGATGPWDYLDL--RQPLPSSCRDTVSG--------NAFFN------- 190

  Fly   197 GCLD-------GFSGYISAHAVSLGAAGVVIAILQF 225
            ||:|       |.:|:|.|.|::||...|:.|::.|
  Fly   191 GCVDELTWFFEGKTGWIVALAMTLGLLNVICAVMSF 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp29FaNP_001162915.1 Tetraspannin 11..238 CDD:278750 61/231 (26%)
tetraspanin_LEL 106..210 CDD:239401 28/112 (25%)
Tsp2ANP_001188523.1 Tetraspannin 18..232 CDD:278750 61/231 (26%)
tetraspanin_LEL 116..204 CDD:239401 25/109 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.