DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp29Fa and tsp-15

DIOPT Version :9

Sequence 1:NP_001162915.1 Gene:Tsp29Fa / 34211 FlyBaseID:FBgn0032074 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_492404.1 Gene:tsp-15 / 192065 WormBaseID:WBGene00006641 Length:258 Species:Caenorhabditis elegans


Alignment Length:190 Identity:49/190 - (25%)
Similarity:84/190 - (44%) Gaps:19/190 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLLTGSANAVKYTLFGFN-----LIFLITGIILIAVGAGVGAVYTGYKLFLAGKFFSIPTFLIV 60
            |..|..||...:..|..|:     ||.::..|..|..|..:.|..:.|...::...:.....::|
 Worm     1 MGALGDSAYGARGRLIKFSYIVTALISILFSISCICYGIWLLARRSQYAELVSPSLYVDVGRILV 65

  Fly    61 IGSFIIIISFFGCWGAL-KENYCLVLSFSVMLAIIFILELAAGISGYVLRNDASDL--IKTSLTY 122
            |.|.:.|:::..|:.|: ||..|.|.|.:|...:|.::.:..|..|...|:..:..  :...:..
 Worm    66 IISILSILNYLICFYAIFKEMRCFVTSCAVASIVIAVMLIIGGCIGLNFRDQLTHYTPLNLKMLT 130

  Fly   123 SLNE-YNSINPNATTKLWDDIQDEFECCGVTSYND---WITA-------FPNGDLPISCC 171
            ||.| |.:.:....|:.||.:|..|:||||...::   |.|:       .|...:|.|||
 Worm   131 SLRELYGTHDMKGITESWDALQSNFKCCGVNGTDNAQIWKTSKWYMHQRAPKLLIPESCC 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp29FaNP_001162915.1 Tetraspannin 11..238 CDD:278750 45/180 (25%)
tetraspanin_LEL 106..210 CDD:239401 21/79 (27%)
tsp-15NP_492404.1 Tetraspannin 16..256 CDD:278750 44/175 (25%)
uroplakin_I_like_LEL 110..228 CDD:239409 22/81 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.