DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp29Fa and Tspan8

DIOPT Version :9

Sequence 1:NP_001162915.1 Gene:Tsp29Fa / 34211 FlyBaseID:FBgn0032074 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_598210.1 Gene:Tspan8 / 171048 RGDID:621783 Length:235 Species:Rattus norvegicus


Alignment Length:249 Identity:58/249 - (23%)
Similarity:120/249 - (48%) Gaps:31/249 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTGSANAVKYTLFGFNLIFLITGIILIAVGAGVGAVYTGYKLFLAG-----KFFSIPTFLIVIGS 63
            :.|.:..:||::|.||.:|.:.|.:::.:...:.....|.::..:|     .|.:: ..||.:||
  Rat     1 MAGVSGCLKYSMFFFNFLFWVCGTLILGLAIWLRVSKDGKEIITSGDNGTNPFIAV-NILIAVGS 64

  Fly    64 FIIIISFFGCWGALKENYCLVLSFSVMLAIIFILELAAGISGYVLRNDASDLIKTS-------LT 121
            .|:::.|.||.||:||:.|::|.|.:.|.:|.:|::||||.|...::::|.::..:       |:
  Rat    65 IIMVLGFLGCCGAVKESRCMLLLFFIGLLLILLLQVAAGILGATFKSESSRILNETLYENAKLLS 129

  Fly   122 YSLNEYNSINPNATTKLWDDIQDEFECCGVT-SYNDWITAFPNGDLPISCCNVHVGAVGTFTCNN 185
            .:.||...:.     |.....|.||:|||:. ...||...||:......|           |.::
  Rat   130 ETSNEAKEVQ-----KAMIAFQSEFKCCGLRFGAADWGKNFPDAKESCQC-----------TGSD 178

  Fly   186 AQSSVADR-HKVGCLDGFSGYISAHAVSLGAAGVVIAILQFFGVIFACYIAREI 238
            .:|...:. ::..||......:..:.:.:......:|:::..|::|:..:..:|
  Rat   179 CESYNGENVYRTTCLSLIKELVEKNIIIVIGIAFGLAVIEILGLVFSMVLYCQI 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp29FaNP_001162915.1 Tetraspannin 11..238 CDD:278750 56/240 (23%)
tetraspanin_LEL 106..210 CDD:239401 20/112 (18%)
Tspan8NP_598210.1 Tetraspannin 8..228 CDD:395265 56/236 (24%)
TM4SF3_like_LEL 106..204 CDD:239407 21/113 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.