DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp29Fa and cd151

DIOPT Version :9

Sequence 1:NP_001162915.1 Gene:Tsp29Fa / 34211 FlyBaseID:FBgn0032074 Length:248 Species:Drosophila melanogaster
Sequence 2:XP_031755690.1 Gene:cd151 / 100144686 XenbaseID:XB-GENE-480009 Length:266 Species:Xenopus tropicalis


Alignment Length:248 Identity:71/248 - (28%)
Similarity:116/248 - (46%) Gaps:26/248 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VKYTLFGFNLIFLITGIILIAVGAGVGAVYTGYKLFLAGKFFSIPTFLIVI-GSFIIIISFFGCW 74
            :||.||.||..|.:.|:.::|||.......:.|...|....::...:::|| |:.::|....||.
 Frog    22 LKYLLFTFNFFFWLAGLAVMAVGIWTLIQKSDYISLLPSNTYAATAYILVIAGAIVMITGILGCC 86

  Fly    75 GALKENYCLVLSFSVMLAIIFILELAAGISGYV-----------LRNDASDLIKTSLTYSLNEYN 128
            ...||...|:..:.::|..|||||:.|||..|:           |..:....:|.::|   .:|.
 Frog    87 ATFKERKSLLKVYFILLLCIFILEVLAGILAYIYYQQCTPFCLQLNAELKQSLKQTMT---TKYK 148

  Fly   129 SINPNATTKLWDDIQDEFECCGVTSYNDWITAF----PNGD---LPISCCNVHVGAVGTFTCNNA 186
            .......|...|.:|.||:|||..:..||..:.    |..:   :|.|||.......|   ..:.
 Frog   149 QPGEEKVTNAVDKLQQEFKCCGSNNSEDWRDSIWINSPEAEKRLVPDSCCKTVTQRCG---IRDH 210

  Fly   187 QSSVADRHKVGCLDGFSGYISAHAVSLGAAGVVIAILQFFGVIFACYIAREIK 239
            .|::. :.:.||:.....:|.||.:.:||.|:.||.:|.||:||.|.:.|.:|
 Frog   211 PSNIY-KTEGGCITKLETFIRAHLLIIGAVGIGIACVQLFGMIFTCCLYRSLK 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp29FaNP_001162915.1 Tetraspannin 11..238 CDD:278750 70/245 (29%)
tetraspanin_LEL 106..210 CDD:239401 26/121 (21%)
cd151XP_031755690.1 Tetraspannin 22..257 CDD:395265 69/241 (29%)
CD151_like_LEL 118..233 CDD:239408 26/121 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4418
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.