DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IDH3G and Idh3a

DIOPT Version :9

Sequence 1:NP_004126.1 Gene:IDH3G / 3421 HGNCID:5386 Length:393 Species:Homo sapiens
Sequence 2:NP_001259705.1 Gene:Idh3a / 32940 FlyBaseID:FBgn0027291 Length:377 Species:Drosophila melanogaster


Alignment Length:368 Identity:155/368 - (42%)
Similarity:229/368 - (62%) Gaps:25/368 - (6%)


- Green bases have known domain annotations that are detailed below.


Human    28 VLGAHEVP---SRNIFSEQTIPPSAK---YGGRHTVTMIPGDGIGPELMLHVKSVFRHACVPVDF 86
            ::.|.:.|   :....|:....|:|.   ..|...||:|||||||||:...|:.:|..|.||:::
  Fly    15 LIAARDAPAVTATPAVSQVNATPAASRSYSSGTKKVTLIPGDGIGPEISAAVQKIFTAANVPIEW 79

Human    87 EEVHVSSNADEEDIRN----------AIMAIRRNRVALKGNIETNHNLPPSHKSRNNILRTSLDL 141
            |.|.|:      .:|.          ||.::..|::.|||.:.|  .:...|:|.|..||...:|
  Fly    80 EAVDVT------PVRGPDGKFGIPQAAIDSVNTNKIGLKGPLMT--PVGKGHRSLNLALRKEFNL 136

Human   142 YANVIHCKSLPGVVTRHKDIDILIVRENTEGEYSSLEHESVAGVVESLKIITKAKSLRIAEYAFK 206
            ||||..|:||.|..|.:.|:|::.:|||||||||.:|||.|.|||:|:|:||:..|.|:|||||:
  Fly   137 YANVRPCRSLEGYKTLYDDVDVVTIRENTEGEYSGIEHEIVDGVVQSIKLITEEASKRVAEYAFQ 201

Human   207 LAQESGRKKVTAVHKANIMKLGDGLFLQCCREVAARYPQITFENMIVDNTTMQLVSRPQQFDVMV 271
            .|:.:.|||||.|||||||::.|||||:|.|::|.::|:|.||...:|...:.:|..|.::||:|
  Fly   202 YAKNNNRKKVTVVHKANIMRMSDGLFLRCVRDMAQKFPEIQFEEKYLDTVCLNMVQNPGKYDVLV 266

Human   272 MPNLYGNIVNNVCAGLVGGPGLVAGANYGHVYAVFETATRNTGKSIANKNIANPTATLLASCMML 336
            ||||||:|::::|||||||.||....|.|...|:|| :...|...||.|::|||||.||::.|||
  Fly   267 MPNLYGDILSDMCAGLVGGLGLTPSGNMGLNGALFE-SVHGTAPDIAGKDLANPTALLLSAVMML 330

Human   337 DHLKLHSYATSIRKAVLASMDNENMHTPDIGGQGTTSEAIQDV 379
            .|::|::||..|.:|...::......|.|:||:...||...::
  Fly   331 RHMELNTYADKIERAAFETIKEGKYLTGDLGGRAKCSEFTNEI 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IDH3GNP_004126.1 mito_nad_idh 52..383 CDD:272942 150/338 (44%)
Idh3aNP_001259705.1 Iso_dh 46..377 CDD:294303 150/337 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0473
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53770
OrthoDB 1 1.010 - - D325037at33208
OrthoFinder 1 1.000 - - FOG0000244
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X402
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.