DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IDH3B and CG5028

DIOPT Version :9

Sequence 1:NP_001317692.1 Gene:IDH3B / 3420 HGNCID:5385 Length:387 Species:Homo sapiens
Sequence 2:NP_001097922.1 Gene:CG5028 / 43102 FlyBaseID:FBgn0039358 Length:402 Species:Drosophila melanogaster


Alignment Length:391 Identity:160/391 - (40%)
Similarity:243/391 - (62%) Gaps:17/391 - (4%)


- Green bases have known domain annotations that are detailed below.


Human    10 LTRALVSAGNPGAWRGL-------STSAAAHAASRSQAE-------DVRVEGSFPVTMLPGDGVG 60
            ||:.|:....|...||.       .|...||..|..|.:       ..:..|...||||||.|:|
  Fly     5 LTQRLLQTQTPFLTRGYPLLVTKEKTEDVAHTKSALQKKVTGTDIPSAQYGGRHAVTMLPGGGIG 69

Human    61 PELMHAVKEVFKAAAVPVEFQEHHLSEVQNMASEEKLEQVLSSMKENKVAIIGKIHTPMEYKGEL 125
            ||||..|:|:|:....|::|:...:.  .:....:.|:..::|:|.|.||:.|.|.|..:...|:
  Fly    70 PELMGYVREIFRYCGAPIDFEVIDID--PSTEGNDDLDYAITSIKRNGVALKGNIETKSQSLTEV 132

Human   126 ASYDMRLRRKLDLFANVVHVKSLPGYMTRHNNLDLVIIREQTEGEYSSLEHESARGVIECLKIVT 190
             |.::.:|.:|||:.||||.||.||...||:::|:|:||:.|:|||:.|||||..|::|.:|:||
  Fly   133 -SRNVAIRNELDLYVNVVHCKSYPGIPARHHDIDVVLIRQNTDGEYAMLEHESVPGIVESMKVVT 196

Human   191 RAKSQRIAKFAFDYATKKGRGKVTAVHKANIMKLGDGLFLQCCEEVAELYPKIKFETMIIDNCCM 255
            ...::|:|::||::|.:..|.|||.:||||||||.|||||:....|.:.||:::...|||||.||
  Fly   197 VENAERVARYAFEFARQNNRKKVTTIHKANIMKLSDGLFLEVANRVHKDYPELEHNNMIIDNTCM 261

Human   256 QLVQNPYQFDVLVMPNLYGNIIDNLAAGLVGGAGVVPGESYSAEYAVFETGARHPFAQAVGRNIA 320
            |.|.||:||||:.|.||||.|:.|:..||:||||::.|.:|...||:||.|.|:......|:|||
  Fly   262 QSVSNPHQFDVMNMTNLYGTIVSNVLCGLMGGAGLISGRNYGDHYAIFEPGTRNTGTAIAGKNIA 326

Human   321 NPTAMLLSASNMLRHLNLEYHSSMIADAVKKVIKVGKVRTRDMGGYSTTTDFIKSVIGHLQTKGS 385
            ||.||:.::.:||.||..:.|:::|.:||.:.|....:||.|:||.:::||.:::::..|..|..
  Fly   327 NPVAMISASIDMLNHLGHKEHANVIQEAVYQTIVNDAIRTPDIGGTNSSTDVVENILKILSAKRV 391

Human   386 N 386
            |
  Fly   392 N 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IDH3BNP_001317692.1 None
CG5028NP_001097922.1 mito_nad_idh 55..386 CDD:272942 146/333 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0473
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53770
OrthoDB 1 1.010 - - D325037at33208
OrthoFinder 1 1.000 - - FOG0000244
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101342
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R585
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.760

Return to query results.
Submit another query.