DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IDH3B and Idh3a

DIOPT Version :9

Sequence 1:NP_001317692.1 Gene:IDH3B / 3420 HGNCID:5385 Length:387 Species:Homo sapiens
Sequence 2:NP_001259705.1 Gene:Idh3a / 32940 FlyBaseID:FBgn0027291 Length:377 Species:Drosophila melanogaster


Alignment Length:353 Identity:150/353 - (42%)
Similarity:230/353 - (65%) Gaps:13/353 - (3%)


- Green bases have known domain annotations that are detailed below.


Human    31 AAHAASRSQAEDVRVEGSFPVTMLPGDGVGPELMHAVKEVFKAAAVPVEFQEHHLSEVQNMASEE 95
            |..|||||.:     .|:..||::||||:|||:..||:::|.||.||:|::...::.|:....:.
  Fly    35 ATPAASRSYS-----SGTKKVTLIPGDGIGPEISAAVQKIFTAANVPIEWEAVDVTPVRGPDGKF 94

Human    96 KLEQ-VLSSMKENKVAIIGKIHTPMEYKGELASYDMRLRRKLDLFANVVHVKSLPGYMTRHNNLD 159
            .:.| .:.|:..||:.:.|.:.||:. ||. .|.::.||::.:|:|||...:||.||.|.::::|
  Fly    95 GIPQAAIDSVNTNKIGLKGPLMTPVG-KGH-RSLNLALRKEFNLYANVRPCRSLEGYKTLYDDVD 157

Human   160 LVIIREQTEGEYSSLEHESARGVIECLKIVTRAKSQRIAKFAFDYATKKGRGKVTAVHKANIMKL 224
            :|.|||.||||||.:|||...||::.:|::|...|:|:|::||.||....|.|||.|||||||::
  Fly   158 VVTIRENTEGEYSGIEHEIVDGVVQSIKLITEEASKRVAEYAFQYAKNNNRKKVTVVHKANIMRM 222

Human   225 GDGLFLQCCEEVAELYPKIKFETMIIDNCCMQLVQNPYQFDVLVMPNLYGNIIDNLAAGLVGGAG 289
            .|||||:|..::|:.:|:|:||...:|..|:.:||||.::||||||||||:|:.::.||||||.|
  Fly   223 SDGLFLRCVRDMAQKFPEIQFEEKYLDTVCLNMVQNPGKYDVLVMPNLYGDILSDMCAGLVGGLG 287

Human   290 VVPGESYSAEYAVFET--GARHPFAQAVGRNIANPTAMLLSASNMLRHLNLEYHSSMIADAVKKV 352
            :.|..:.....|:||:  |.....|   |:::|||||:||||..||||:.|..::..|..|..:.
  Fly   288 LTPSGNMGLNGALFESVHGTAPDIA---GKDLANPTALLLSAVMMLRHMELNTYADKIERAAFET 349

Human   353 IKVGKVRTRDMGGYSTTTDFIKSVIGHL 380
            ||.||..|.|:||.:..::|...:...|
  Fly   350 IKEGKYLTGDLGGRAKCSEFTNEICAKL 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IDH3BNP_001317692.1 None
Idh3aNP_001259705.1 Iso_dh 46..377 CDD:294303 143/335 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0473
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53770
OrthoDB 1 1.010 - - D325037at33208
OrthoFinder 1 1.000 - - FOG0000244
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.