DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IDH3B and CG32026

DIOPT Version :9

Sequence 1:NP_001317692.1 Gene:IDH3B / 3420 HGNCID:5385 Length:387 Species:Homo sapiens
Sequence 2:NP_729420.1 Gene:CG32026 / 317829 FlyBaseID:FBgn0052026 Length:719 Species:Drosophila melanogaster


Alignment Length:366 Identity:137/366 - (37%)
Similarity:219/366 - (59%) Gaps:19/366 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    25 GLSTSAAAHAASRSQAEDVRVEGSFPVTMLPGDGVGPELMHAVKEVFKAAAVPVEFQEHHLSEVQ 89
            |......|...|...:.:.||     :|::||||:|||:..||.::.:||..|:.|:...::.|.
  Fly   364 GQGQKGGAGGKSGKASGEPRV-----ITLMPGDGIGPEISMAVIKILEAAKTPLIFEPVDVTPVL 423

Human    90 NMASEEKL-EQVLSSMKENKVAIIGKIHTPMEYKGE-LASYDMRLRRKLDLFANVVHVKSLPGYM 152
            |......: |||:.||...||.:.|.:.||:   |. ..|.::.||:..:|:||:...:||||..
  Fly   424 NSQGMTSVPEQVIESMNRTKVGLKGPLMTPV---GTGFRSLNLTLRQLFNLYANIRPCRSLPGVE 485

Human   153 TRHNNLDLVIIREQTEGEYSSLEHESARGVIECLKIVTRAKSQRIAKFAFDYATKKGRGKVTAVH 217
            |.:.::|:|.|||.||||||.:||....||::.:|::||..|.|:|::.|.||....|.|||||.
  Fly   486 TVYGDVDIVTIRENTEGEYSGIEHTLVNGVVQSIKLITRNASLRVAEYTFQYALAMKRKKVTAVA 550

Human   218 KANIMKLGDGLFLQCCEEVAELYPK------IKFETMIIDNCCMQLVQNPYQFDVLVMPNLYGNI 276
            ::.:|::.|||||:|..|:|..|..      ||:|...:...|:.:||:|.::|:||:|||||:|
  Fly   551 ESQVMRMSDGLFLRCVREMAAKYKSKMDQAGIKYEESTMTTVCLNIVQDPKRYDMLVLPNLYGDI 615

Human   277 IDNLAAGLVGGAGVVPGESYSAEYAVFETGARHPFAQAV-GRNIANPTAMLLSASNMLRHLNLEY 340
            |.:..|||:||.|:.|..:.....|:||  :.|..|..: |:::|||||:|||:..||.::.|..
  Fly   616 ISDTCAGLIGGLGLTPSGNVGTNGAIFE--SVHGTAPDIAGKDLANPTALLLSSVMMLHYIGLHE 678

Human   341 HSSMIADAVKKVIKVGKVRTRDMGGYSTTTDFIKSVIGHLQ 381
            |:..|..||.|.|:...:||.|:||.:..:::..::|.:|:
  Fly   679 HADKIEKAVLKTIRDDNIRTMDLGGKAKCSEYTDALIKNLK 719

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IDH3BNP_001317692.1 None
CG32026NP_729420.1 FGF-BP1 <281..361 CDD:284004
Iso_dh 382..718 CDD:294303 133/345 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0473
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D325037at33208
OrthoFinder 1 1.000 - - FOG0000244
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.