DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trs23 and trappc1

DIOPT Version :10

Sequence 1:NP_609247.1 Gene:Trs23 / 34197 FlyBaseID:FBgn0260861 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001008076.1 Gene:trappc1 / 493438 XenbaseID:XB-GENE-1010136 Length:145 Species:Xenopus tropicalis


Alignment Length:97 Identity:29/97 - (29%)
Similarity:52/97 - (53%) Gaps:4/97 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 MFYPLFAIAS---QLSPEPKSSGIEILEADTFTLHCFQTLTGIKFIIISETGLNGIDLLLRKVYE 175
            |:..||:|.|   ::||.....|....:...:.||.::|.:|:|.::.::..:.....:|.::|.
 Frog    38 MYGMLFSIRSFVGKMSPVDMKDGFLSFQTSKYKLHYYETPSGLKMVMNTDLSVGSTREILHQIYS 102

  Fly   176 -LYSDYVLKNPFYSLEMPIRCELFDNKLQELL 206
             :|.:||:||...||..||:.|||..||...:
 Frog   103 TIYVEYVVKNSLCSLNEPIQSELFKTKLDTFI 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trs23NP_609247.1 TRAPPC4_synbindin 99..205 CDD:341446 29/94 (31%)
trappc1NP_001008076.1 TRAPPC1_MUM2 4..133 CDD:341445 29/94 (31%)

Return to query results.
Submit another query.