DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PrBP and NSE5

DIOPT Version :9

Sequence 1:NP_609246.1 Gene:PrBP / 34196 FlyBaseID:FBgn0032059 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_013689.1 Gene:NSE5 / 854985 SGDID:S000004485 Length:556 Species:Saccharomyces cerevisiae


Alignment Length:141 Identity:27/141 - (19%)
Similarity:50/141 - (35%) Gaps:40/141 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 HEARVPVK--ILDMRA------VSREINFSTIESMENFRLDQKVL-----------FKGRIMEEW 91
            ||..:|:.  ::|:.:      :..|:..:..:|:...||.:..|           |..|..|..
Yeast   237 HEIWMPLLEILIDLFSCRQDYFIQHEVAQNVSKSLFVQRLSESPLAVFFESLNTRNFANRFSEYV 301

  Fly    92 FFEMGFV---------------GANT-TNTWQSTIEAAP-----ESQMMPAKVLNGNVTIQTSFY 135
            |....:.               |.|| .:|:..||:.:|     :|..:..|::.....:.....
Yeast   302 FLNCDYKLPSDNYATPVHPVYNGENTIVDTYIPTIKCSPLYKSQKSLALRRKLIGSCFKLLLRVP 366

  Fly   136 DNETLITKSVV 146
            |...|||..:|
Yeast   367 DGHRLITPRIV 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PrBPNP_609246.1 GMP_PDE_delta 11..150 CDD:398820 27/141 (19%)
NSE5NP_013689.1 Nse5 1..517 CDD:370066 27/141 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.845196 Normalized mean entropy S242
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.