DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PrBP and pde6d

DIOPT Version :9

Sequence 1:NP_609246.1 Gene:PrBP / 34196 FlyBaseID:FBgn0032059 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001002708.1 Gene:pde6d / 436981 ZFINID:ZDB-GENE-040718-463 Length:150 Species:Danio rerio


Alignment Length:149 Identity:90/149 - (60%)
Similarity:116/149 - (77%) Gaps:0/149 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SDDQSAGDRIQKGFQINYMILRDADSGKIIWQENKDFSAPDQEHEARVPVKILDMRAVSREINFS 67
            |.|:.....|.|||::|:|.||||::||::||..:|.|.|..|||||||.|||..:|||||:|||
Zfish     2 SSDEDRAKEILKGFKLNWMNLRDAETGKVLWQGTEDLSLPGVEHEARVPKKILKCKAVSRELNFS 66

  Fly    68 TIESMENFRLDQKVLFKGRIMEEWFFEMGFVGANTTNTWQSTIEAAPESQMMPAKVLNGNVTIQT 132
            ::|.:|.|||:|||.|||:.:||||||.|||..|:||||||.||||||||||||.||.|||.|:|
Zfish    67 SVEKLEKFRLEQKVFFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPANVLTGNVVIET 131

  Fly   133 SFYDNETLITKSVVRLYYI 151
            .|:|::..::.|.|||:|:
Zfish   132 KFFDDDLHVSTSRVRLFYV 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PrBPNP_609246.1 GMP_PDE_delta 11..150 CDD:398820 87/138 (63%)
pde6dNP_001002708.1 GMP_PDE_delta 9..149 CDD:310156 87/139 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592153
Domainoid 1 1.000 188 1.000 Domainoid score I3235
eggNOG 1 0.900 - - E1_KOG4038
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1954
Inparanoid 1 1.050 193 1.000 Inparanoid score I3831
OMA 1 1.010 - - QHG57142
OrthoDB 1 1.010 - - D1192412at2759
OrthoFinder 1 1.000 - - FOG0007479
OrthoInspector 1 1.000 - - oto39070
orthoMCL 1 0.900 - - OOG6_105846
Panther 1 1.100 - - LDO PTHR12976
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2716
SonicParanoid 1 1.000 - - X5607
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.