DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PrBP and Pde6d

DIOPT Version :9

Sequence 1:NP_609246.1 Gene:PrBP / 34196 FlyBaseID:FBgn0032059 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_032827.1 Gene:Pde6d / 18582 MGIID:1270843 Length:150 Species:Mus musculus


Alignment Length:151 Identity:94/151 - (62%)
Similarity:119/151 - (78%) Gaps:1/151 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGSDDQSAGDRIQKGFQINYMILRDADSGKIIWQENKDFSAPDQEHEARVPVKILDMRAVSREIN 65
            |.:.|:.|.| |.:||::|:|.||||::|||:||..:|.|.|..|||||||.|||..:|||||:|
Mouse     1 MSAKDERARD-ILRGFKLNWMNLRDAETGKILWQGTEDLSVPGVEHEARVPKKILKCKAVSRELN 64

  Fly    66 FSTIESMENFRLDQKVLFKGRIMEEWFFEMGFVGANTTNTWQSTIEAAPESQMMPAKVLNGNVTI 130
            ||:.|.||.|||:|||.|||:.:||||||.|||..|:||||||.||||||||||||.||.|||.|
Mouse    65 FSSAEQMEKFRLEQKVYFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPASVLTGNVII 129

  Fly   131 QTSFYDNETLITKSVVRLYYI 151
            :|.|:|::.|::.|.|||:|:
Mouse   130 ETKFFDDDLLVSTSKVRLFYV 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PrBPNP_609246.1 GMP_PDE_delta 11..150 CDD:398820 89/138 (64%)
Pde6dNP_032827.1 GMP_PDE_delta 10..149 CDD:398820 90/139 (65%)
Required for association with membranes. /evidence=ECO:0000250 144..150 3/5 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846938
Domainoid 1 1.000 191 1.000 Domainoid score I3241
eggNOG 1 0.900 - - E1_KOG4038
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1954
Inparanoid 1 1.050 195 1.000 Inparanoid score I3820
Isobase 1 0.950 - 0.845196 Normalized mean entropy S242
OMA 1 1.010 - - QHG57142
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007479
OrthoInspector 1 1.000 - - oto94737
orthoMCL 1 0.900 - - OOG6_105846
Panther 1 1.100 - - LDO PTHR12976
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2716
SonicParanoid 1 1.000 - - X5607
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.740

Return to query results.
Submit another query.