DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9287 and si:dkey-193c22.1

DIOPT Version :9

Sequence 1:NP_609244.1 Gene:CG9287 / 34194 FlyBaseID:FBgn0032057 Length:625 Species:Drosophila melanogaster
Sequence 2:NP_001093504.1 Gene:si:dkey-193c22.1 / 567837 ZFINID:ZDB-GENE-030131-7957 Length:370 Species:Danio rerio


Alignment Length:217 Identity:47/217 - (21%)
Similarity:77/217 - (35%) Gaps:59/217 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 SRLPVLVYIHGEYLYEGSNSEAPPDYLL-------EKDVVLVTPQYRLGPFGFLSTKTDEIPGNA 188
            |.:||:|:::|.....|..|    .|.|       |.:..::.|.|.:.|.|.:.....      
Zfish   116 SPVPVVVFVYGGAWGSGDRS----IYCLLALQMAKELNASVICPDYSIYPKGNVLNMVQ------ 170

  Fly   189 GFLDIFLALQFVKHFIKYFGGDPSRVTVAGQVGGAAIAHLLTLSPVVQRGLFHQVIYHSGSAIMP 253
               ||..:|.:|:.....|..|...:.:.|...|   |||..|:     .||      ..|.:..
Zfish   171 ---DISDSLLWVRQKGHAFSLDQDNIILIGHSAG---AHLCALT-----SLF------LASNVEE 218

  Fly   254 IFLEEDPRKHAQEIAKKADCKMVTVRDLNTCLMELTALELLTAFMEH-------ALE-KSDLGIG 310
            :|:|.:.:|                 ||.|.:..:..|..:.:.|:|       |:| .|.:...
Zfish   219 LFIETNKQK-----------------DLVTAIKGIIGLSGVYSIMDHYNHEKVRAVEYVSTMHKA 266

  Fly   311 HTGGIQFTIGGPSGVLPKHPYD 332
            ..|...|....|:.:|.|...|
Zfish   267 MDGVENFDYYSPTSLLKKMKED 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9287NP_609244.1 COesterase 31..558 CDD:278561 47/217 (22%)
si:dkey-193c22.1NP_001093504.1 Aes 87..336 CDD:223730 47/217 (22%)
Abhydrolase 121..>210 CDD:304388 23/109 (21%)
Abhydrolase 167..336 CDD:304388 33/162 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.