DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9287 and LOC4576393

DIOPT Version :10

Sequence 1:NP_609244.1 Gene:CG9287 / 34194 FlyBaseID:FBgn0032057 Length:625 Species:Drosophila melanogaster
Sequence 2:XP_061496509.1 Gene:LOC4576393 / 4576393 VectorBaseID:AGAMI1_007775 Length:381 Species:Anopheles gambiae


Alignment Length:31 Identity:11/31 - (35%)
Similarity:15/31 - (48%) Gaps:4/31 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDTVKLFTVLLICASLMLITEAQLTFTPAWG 31
            ||.:||..||    .|.:.:.|.|..:|..|
Mosquito    24 MDRIKLKKVL----GLTVCSNAALDVSPVSG 50

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9287NP_609244.1 COesterase 33..558 CDD:395084
LOC4576393XP_061496509.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.